Result : EXP03882
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03882 |
| NCBI Accession ID | |
| Organism | Escherichia |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGACTAAGAGCACCACGATGATGAGTAGCTTCATCATGACCCTTTCCTTATTTAAGGCCCCTTCCTCGGGAGGGGCTTTCCCGTTTCAGCGTCCCGCTGAAATCGTCGGCTTACCTCCTTTCGCCATGCACTTAGTCTATCGCTGA |
| Sequence | MTKSTTMMSSFIMTLSLFKAPSSGGAFPFQRPAEIVGLPPFAMHLVYR |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 48 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2153700 | 2153846 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1142672 | 1142797 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 3 | 1142979 | 1143125 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 4 | 2828940 | 2829086 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 2828633 | 2828758 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10077.11 | 1.0 | 2 | 2047 | same-strand | Uncharacterized protein conserved in bacteria (DUF2314) |
| 2 | PF13672.8 | 1.0 | 2 | 1221 | opposite-strand | Protein phosphatase 2C |
| 3 | PF00092.30 | 1.0 | 2 | 565 | opposite-strand | von Willebrand factor type A domain |
| 4 | PF13519.8 | 1.0 | 2 | 565 | opposite-strand | von Willebrand factor type A domain |
| 5 | PF13533.8 | 1.0 | 2 | 378 | same-strand | Biotin-lipoyl like |
| 6 | PF13437.8 | 1.0 | 2 | 378 | same-strand | HlyD family secretion protein |
| 7 | PF16576.7 | 1.0 | 2 | 378 | same-strand | Barrel-sandwich domain of CusB or HlyD membrane-fusion |
| 8 | PF00873.21 | 1.0 | 2 | 3307.0 | same-strand | AcrB/AcrD/AcrF family |
| 9 | PF02355.18 | 1.0 | 2 | 4540 | same-strand | Protein export membrane protein |
| 10 | PF07690.18 | 1.0 | 2 | 7946 | same-strand | Major Facilitator Superfamily |
| 11 | PF02518.28 | 1.0 | 2 | 9194.5 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 12 | PF00672.27 | 1.0 | 2 | 9194.5 | same-strand | HAMP domain |
| 13 | PF00512.27 | 1.0 | 2 | 9194.5 | same-strand | His Kinase A (phospho-acceptor) domain |
++ More..