| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YfzA |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 875428 |
| Right | 875694 |
| Strand | + |
| Nucleotide Sequence | ATGGATAAAGTATATAAAAGAAGTTGGTTTCAAACATTTTTGGCATTTTTAGTATCTCAGCTTTATTTTAATTTTGTAGAATTAACGGGATGGGGTCCTAAGTATAGAGAAATGAATGGATTCCCAGCAAACATAGTTGAACTAGATTTCTTTCAAACATATCTTTCATTCTATGATAATCCATGGTTTAATATTATTACTGTTTTCTTGGGAGTTTTCACTATTATACAAATAATTACAGGGATAACAAAGGATATTCGAAATTAA |
| Sequence | MDKVYKRSWFQTFLAFLVSQLYFNFVELTGWGPKYREMNGFPANIVELDFFQTYLSFYDNPWFNIITVFLGVFTIIQIITGITKDIRN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam14118. Profile Description: YfzA-like protein. The YfzA-like protein family includes the B. subtilis YfzA protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 100 amino acids in length. |
| Pubmed ID | 9384377 |
| Domain | CDD:290824 |
| Functional Category | Others |
| Uniprot ID | C0H3X6 |
| ORF Length (Amino Acid) | 88 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 875428 | 875694 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 814412 | 814693 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 3 | 3133285 | 3133584 | - | NZ_CP011937.1 | Bacillus velezensis |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03446.17 | 1.0 | 3 | 4978 | opposite-strand | NAD binding domain of 6-phosphogluconate dehydrogenase |
| 2 | PF14833.8 | 1.0 | 3 | 4978 | opposite-strand | NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase |
| 3 | PF01544.20 | 1.0 | 3 | 3257 | opposite-strand | CorA-like Mg2+ transporter protein |
| 4 | PF00730.27 | 1.0 | 3 | 2287 | same-strand | HhH-GPD superfamily base excision DNA repair protein |
| 5 | PF01938.22 | 1.0 | 3 | 741 | same-strand | TRAM domain |
| 6 | PF01207.19 | 1.0 | 3 | 810 | same-strand | Dihydrouridine synthase (Dus) |
| 7 | PF00676.22 | 1.0 | 3 | 2768 | same-strand | Dehydrogenase E1 component |
| 8 | PF02775.23 | 1.0 | 3 | 2768 | same-strand | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain |
| 9 | PF02779.26 | 1.0 | 3 | 3771 | same-strand | Transketolase, pyrimidine binding domain |
| 10 | PF02780.22 | 1.0 | 3 | 3771 | same-strand | Transketolase, C-terminal domain |
| 11 | PF00198.25 | 0.67 | 2 | 4783.0 | same-strand | 2-oxoacid dehydrogenases acyltransferase (catalytic domain) |
| 12 | PF00364.24 | 0.67 | 2 | 4783.0 | same-strand | Biotin-requiring enzyme |
| 13 | PF02817.19 | 0.67 | 2 | 4783.0 | same-strand | e3 binding domain |