Result : EXP03871
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03871 |
| NCBI Accession ID | |
| Organism | Leptotrichia |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | GTGCTGATAAAGGAATTAAGATTATTAACAAGAGGAACAGTAATTGTTGATAAGGAAGGTACTGTGCAATATGTTGAATATGTACCTGAAGTTGCTACAGAACCTGATTACAGCAAAGCACTGGAAGTAATAAAAACATTAATATAA |
| Sequence | MLIKELRLLTRGTVIVDKEGTVQYVEYVPEVATEPDYSKALEVIKTLI |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 48 |
++ More..
| Conservation Analysis |
No. of Species: 73
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 389737 | 389895 | + | NZ_AP019822.1 | Pseudoleptotrichia goodfellowii |
| 2 | 26022 | 26150 | - | NZ_AP019829.2 | Leptotrichia wadei |
| 3 | 13628 | 13756 | - | NZ_AP019827.1 | Leptotrichia shahii |
| 4 | 2207411 | 2207536 | - | NZ_AP019846.1 | Leptotrichia hongkongensis |
| 5 | 61596 | 61721 | + | NZ_AP019845.1 | Leptotrichia trevisanii |
| 6 | 726913 | 727044 | + | NZ_CP021904.1 | Alkalitalea saponilacus |
| 7 | 1632262 | 1632405 | - | NZ_CP041345.1 | Tenuifilum thalassicum |
| 8 | 250813 | 250935 | + | NZ_AP023049.1 | Alistipes indistinctus |
| 9 | 847184 | 847321 | - | NZ_LT635475.1 | Ezakiella massiliensis |
| 10 | 1076329 | 1076463 | + | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 11 | 35948 | 36070 | + | NZ_LR134523.1 | Peptoniphilus ivorii |
| 12 | 3834932 | 3835054 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 13 | 3175271 | 3175417 | - | NC_010814.1 | Geobacter lovleyi SZ |
| 14 | 2349768 | 2349890 | + | NZ_CP007445.1 | Gilliamella apicola |
| 15 | 17830 | 17976 | + | NC_013720.1 | Pirellula staleyi DSM 6068 |
| 16 | 1403386 | 1403532 | + | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 17 | 1055973 | 1056116 | + | NZ_AP022321.1 | Veillonella nakazawae |
| 18 | 54170 | 54313 | + | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 19 | 1877313 | 1877456 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 20 | 1281016 | 1281165 | + | NZ_CP016538.2 | Planococcus maritimus |
| 21 | 748819 | 748941 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 22 | 1293959 | 1294108 | + | NZ_CP059540.1 | Planococcus maritimus |
| 23 | 1111994 | 1112116 | + | NZ_LR134375.1 | Veillonella dispar |
| 24 | 1035478 | 1035627 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 25 | 1155847 | 1155990 | + | NZ_LR778174.1 | Veillonella parvula |
| 26 | 1094861 | 1095007 | - | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 27 | 1879199 | 1879360 | + | NC_014011.1 | Aminobacterium colombiense DSM 12261 |
| 28 | 1943188 | 1943334 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 29 | 207892 | 208032 | - | NZ_LR134524.1 | Peptoniphilus harei |
| 30 | 7431646 | 7431792 | + | NZ_CP036274.1 | Anatilimnocola aggregata |
| 31 | 3162297 | 3162425 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 32 | 962877 | 963035 | + | NZ_CP012502.1 | Bacillus beveridgei |
| 33 | 2975124 | 2975252 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 34 | 322051 | 322173 | + | NZ_LR214970.1 | Mycoplasmopsis bovigenitalium |
| 35 | 446903 | 447049 | - | NZ_CP036292.1 | Rosistilla oblonga |
| 36 | 3349615 | 3349743 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 37 | 480738 | 480863 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 38 | 2770694 | 2770837 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 39 | 1277931 | 1278077 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 40 | 480634 | 480780 | + | NZ_CP063849.1 | Paludibaculum fermentans |
| 41 | 1281853 | 1281999 | + | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 42 | 1037097 | 1037222 | - | NZ_CP034159.1 | Kaistella carnis |
| 43 | 1317424 | 1317549 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 44 | 649372 | 649494 | - | NZ_CP015108.1 | Sporosarcina ureae |
| 45 | 1432604 | 1432750 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 46 | 1033393 | 1033533 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 47 | 1140844 | 1140969 | + | NZ_CP011937.1 | Bacillus velezensis |
| 48 | 2845768 | 2845893 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 49 | 1144250 | 1144378 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 50 | 2380178 | 2380318 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 51 | 1575284 | 1575436 | - | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 52 | 2473303 | 2473449 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 53 | 4907655 | 4907774 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 54 | 2566131 | 2566289 | - | NC_015732.1 | Treponema caldarium DSM 7334 |
| 55 | 2875263 | 2875406 | - | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 56 | 1262711 | 1262830 | - | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 57 | 2104054 | 2104176 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 58 | 1076707 | 1076829 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 59 | 1126311 | 1126448 | + | NZ_CP042374.1 | Leuconostoc carnosum |
| 60 | 1197107 | 1197244 | + | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 61 | 3459269 | 3459439 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 62 | 906506 | 906652 | + | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 63 | 3112882 | 3113010 | - | NZ_CP042425.1 | Limnoglobus roseus |
| 64 | 5920991 | 5921128 | - | NZ_CP036291.1 | Pirellulimonas nuda |
| 65 | 2267154 | 2267303 | + | NZ_LR027382.1 | Alistipes megaguti |
| 66 | 2184364 | 2184516 | - | NZ_CP034118.1 | Staphylospora marina |
| 67 | 3033609 | 3033755 | + | NC_018011.1 | Alistipes finegoldii DSM 17242 |
| 68 | 1113379 | 1113531 | - | NZ_CP009312.1 | Lawsonella clevelandensis |
| 69 | 447623 | 447775 | - | NZ_CP053187.1 | Turicibacter sanguinis |
| 70 | 1708846 | 1708977 | - | NC_021064.1 | Cutibacterium avidum 44067 |
| 71 | 1375775 | 1375915 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 72 | 3541099 | 3541242 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 73 | 674910 | 675056 | + | NZ_CP011412.1 | Sedimenticola thiotaurini |
| 74 | 1566122 | 1566265 | + | NZ_CP059571.1 | Neisseria bacilliformis |
++ More..