Result : C0H3X3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YezF |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 713308 |
| Right | 713535 |
| Strand | - |
| Nucleotide Sequence | TTGAAGCCAAACATCAGTCTCATCAATGCCGTGTTCAGAATCGCCTGCGGATTGACGATTATGTCAGCCGCCAGTGCAAAGTTTACGAAAAAACCTTGGTGCAGAATGCATCTCTTTTACATCTTTATGGGGGCCATGAAAGCGGGTTCGGGAATCTTGCGCTTCTGTCCTGTGACCTACATGTTTCAACACAGCGATTCTGGAAATAACGAGCATCAAAACGGATAA |
| Sequence | MKPNISLINAVFRIACGLTIMSAASAKFTKKPWCRMHLFYIFMGAMKAGSGILRFCPVTYMFQHSDSGNNEHQNG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam11127. Profile Description: Protein of unknown function (DUF2892). This family is conserved in bacteria. The function is not known. |
| Pubmed ID | 9384377 |
| Domain | CDD:402617 |
| Functional Category | Others |
| Uniprot ID | C0H3X3 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 713308 | 713535 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 677558 | 677791 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 865629 | 865862 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 654090 | 654323 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 692670 | 692903 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 6 | 1296579 | 1296812 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 698309 | 698542 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 3272132 | 3272362 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 674183 | 674413 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 713826 | 714056 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 782275 | 782505 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 764789 | 765019 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 888105 | 888326 | + | NZ_CP043404.1 | Bacillus safensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP033052.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00551.21 | 0.69 | 9 | 4711 | opposite-strand | Formyl transferase |
| 2 | PF01808.20 | 0.77 | 10 | 3176.0 | opposite-strand | AICARFT/IMPCHase bienzyme |
| 3 | PF02142.24 | 0.77 | 10 | 3176.0 | opposite-strand | MGS-like domain |
| 4 | PF01071.21 | 0.77 | 10 | 1892.0 | opposite-strand | Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain |
| 5 | PF02844.17 | 0.77 | 10 | 1892.0 | opposite-strand | Phosphoribosylglycinamide synthetase, N domain |
| 6 | PF02843.18 | 0.77 | 10 | 1892.0 | opposite-strand | Phosphoribosylglycinamide synthetase, C domain |
| 7 | PF02655.16 | 0.77 | 10 | 1892.0 | opposite-strand | ATP-grasp domain |
| 8 | PF13382.8 | 1.0 | 13 | 128 | opposite-strand | Adenine deaminase C-terminal domain |
| 9 | PF01979.22 | 1.0 | 13 | 128 | opposite-strand | Amidohydrolase family |
| 10 | PF11258.10 | 0.92 | 12 | 1897.0 | opposite-strand | Protein of unknown function (DUF3048) N-terminal domain |
| 11 | PF17479.4 | 0.92 | 12 | 1897.0 | opposite-strand | Protein of unknown function (DUF3048) C-terminal domain |
| 12 | PF01371.21 | 1.0 | 13 | 2895 | opposite-strand | Trp repressor protein |
| 13 | PF01645.19 | 0.69 | 9 | 3245 | same-strand | Conserved region in glutamate synthase |
| 14 | PF01884.19 | 0.77 | 10 | 5033.0 | opposite-strand | PcrB family |
++ More..