Result : EXP03858
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03858 |
| NCBI Accession ID | |
| Organism | Capnocytophaga,Prevotella |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGTTATATCTTTGCACCCGCAAACAAGAAAATACTGATTGTCATAATGACTCGGTAGCTCAGCTGGTAGAGCACGACACTCTTAATGTTGGGGTCCAGGGTTCGATCCCCTGCCGGGTCACAGGGTTATACAATTATTGTTATTTTTTATAG |
| Sequence | MLYLCTRKQENTDCHNDSVAQLVEHDTLNVGVQGSIPCRVTGLYNYCYFL |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2570933 | 2571085 | + | NZ_CP022022.1 | Capnocytophaga endodontalis |
| 2 | 553133 | 553285 | + | NZ_CP022379.1 | Capnocytophaga sputigena |
| 3 | 2179421 | 2179546 | + | NZ_CP022378.1 | Capnocytophaga cynodegmi |
| 4 | 549516 | 549641 | - | NZ_CP022387.1 | Capnocytophaga stomatis |
| 5 | 221124 | 221294 | + | NZ_CP032819.1 | Butyricimonas faecalis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP022022.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01202.24 | 0.8 | 4 | 115.0 | opposite-strand | Shikimate kinase |
++ More..