Result : A1QZP7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Nucleoid-associated protein EbfC |
| NCBI Accession ID | CP000049.1 |
| Organism | Borrelia turicatae (strain 91E135) |
| Left | 486031 |
| Right | 486330 |
| Strand | + |
| Nucleotide Sequence | ATGGCAGTAAATCCATTAGATTTTTTAAAGAATATGTCAGGTTTTAAAGATAATATTGATAATTTTAAAAAAGAAATATCCCAAATTGTTGTTTGTGGCAGAGCAGGAAGCGATGTTGTTGTTGTTGAGATGAATGGAGAATTTGTTGTTAAGAAAGTTGTAATTAAGGAAGAATTTTTTAGTGATTTAGATAATGAGGCCCTTGAGCACATGATAAAATCGGCTTTTAATGATGCTATTTCTAAGGTTAAGGAAGAGATAAAGTCAAAAACAATGGGTTCTATTCCATTTGGGATTTAA |
| Sequence | MAVNPLDFLKNMSGFKDNIDNFKKEISQIVVCGRAGSDVVVVEMNGEFVVKKVVIKEEFFSDLDNEALEHMIKSAFNDAISKVKEEIKSKTMGSIPFGI |
| Source of smORF | Swiss-Prot |
| Function | Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection. {ECO:0000255|HAMAP-Rule:MF_00274}. |
| Pubmed ID | |
| Domain | CDD:412410 |
| Functional Category | DNA-binding |
| Uniprot ID | A1QZP7 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 486031 | 486330 | + | NC_008710.1 | Borrelia turicatae 91E135 |
| 2 | 485913 | 486212 | + | NZ_CP007022.1 | Borrelia parkeri HR1 |
| 3 | 488638 | 488937 | + | NZ_CP011060.1 | Borrelia hermsii CC1 |
| 4 | 503298 | 503597 | + | NC_011244.1 | Borrelia recurrentis A1 |
| 5 | 479837 | 480136 | + | NZ_CP013704.1 | Borrelia anserina Es |
| 6 | 422082 | 422381 | - | NZ_CP024333.1 | Borrelia miyamotoi |
| 7 | 502427 | 502726 | + | NZ_CP028884.1 | Borrelia turcica IST7 |
| 8 | 483218 | 483517 | + | NC_015921.1 | Borreliella bissettii DN127 |
| 9 | 487184 | 487483 | + | NZ_CP028861.1 | Borreliella garinii |
| 10 | 485753 | 486052 | + | NZ_CP015796.1 | Borreliella mayonii |
| 11 | 482675 | 482974 | + | NZ_CP044535.1 | Borrelia maritima |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP024333.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08459.13 | 1.0 | 11 | 6197 | opposite-strand | UvrC RIbonuclease H-like domain |
| 2 | PF01541.26 | 1.0 | 11 | 6197 | opposite-strand | GIY-YIG catalytic domain |
| 3 | PF14520.8 | 0.64 | 7 | 6238 | opposite-strand | Helix-hairpin-helix domain |
| 4 | PF13385.8 | 1.0 | 11 | 4564 | same-strand | Concanavalin A-like lectin/glucanases superfamily |
| 5 | PF13424.8 | 0.82 | 9 | 3269 | same-strand | Tetratricopeptide repeat |
| 6 | PF13177.8 | 1.0 | 11 | 4 | same-strand | DNA polymerase III, delta subunit |
| 7 | PF00004.31 | 1.0 | 11 | 4 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 8 | PF12169.10 | 1.0 | 11 | 4 | same-strand | DNA polymerase III subunits gamma and tau domain III |
| 9 | PF13662.8 | 0.64 | 7 | 4 | same-strand | Toprim domain |
| 10 | PF02132.17 | 0.64 | 7 | 4 | same-strand | RecR protein |
| 11 | PF00334.21 | 1.0 | 11 | 807 | same-strand | Nucleoside diphosphate kinase |
| 12 | PF00515.30 | 0.64 | 7 | 3288 | same-strand | Tetratricopeptide repeat |
++ More..