Result : EXP03852
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03852 |
| NCBI Accession ID | |
| Organism | Thermothielavioides |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAATAATAGAATAAAACAATTAAGGAAAGAATTTGGTTTAAGGCAAGAAGATATGGCAAAAAAGTTAGGTGTTACTAGACAAACAATTATTGCTATAGAGAATGATAAATATAATCCGACACTTGAGCTTGCAATGAAAATTGCTTAA |
| Sequence | MNNRIKQLRKEFGLRQEDMAKKLGVTRQTIIAIENDKYNPTLELAMKIA |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of cl22854. Profile Description: N/A. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254. |
| Pubmed ID | 32601270 |
| Domain | CDD:419869 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4884432 | 4884554 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 2 | 4058622 | 4058783 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
++ More..