Protein Information |
Information Type | Description |
---|---|
Protein name | EXP03847 |
NCBI Accession ID | |
Organism | |
Left | |
Right | |
Strand | |
Nucleotide Sequence | ATGAAGTGCCAGCGTGAGTGCCCGGCGGACGCCATCAAGATCGAAAACTTCGTGTCCAAGATCGACTATGACAAGTGCGTCGGCTGCGGCCACTGCGCCGATATCTGCCCGCGCGGCATCATCAACCTGCTCGACATGGTCAAGCAGTAA |
Sequence | MKCQRECPADAIKIENFVSKIDYDKCVGCGHCADICPRGIINLLDMVKQ |
Source of smORF | Metagenomic Ribo-seq |
Function | The ORF matches to the profile of pfam12838. Profile Description: 4Fe-4S dicluster domain. Superfamily includes proteins containing domains which bind to iron-sulfur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Domain contains two 4Fe4S clusters. The ORF matches to the profile of pfam00037. Profile Description: 4Fe-4S binding domain. Superfamily includes proteins containing domains which bind to iron-sulfur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. |
Pubmed ID | 32601270 |
Domain | CDD:403902,CDD:394993 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 49 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4354038 | 4354199 | - | NZ_CP009516.1 | Methanosarcina horonobensis HB-1 = JCM 15518 |
2 | 954156 | 954290 | + | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
3 | 1137330 | 1137455 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
4 | 1033041 | 1033199 | - | NZ_CP048436.1 | Flavonifractor plautii |
5 | 1186633 | 1186773 | - | NC_015152.1 | Sphaerochaeta globosa str. Buddy |
6 | 2061067 | 2061213 | - | NZ_CP030280.1 | Blautia argi |
7 | 40084 | 40206 | - | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
8 | 2988566 | 2988691 | + | NZ_CP018477.1 | Thermogutta terrifontis |
9 | 3436857 | 3437018 | - | NZ_CP009530.1 | Methanosarcina barkeri 227 |
10 | 2620357 | 2620494 | - | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF12838.9 | 0.6 | 6 | 3341 | same-strand | 4Fe-4S dicluster domain |
2 | PF13187.8 | 0.6 | 6 | 3341 | same-strand | 4Fe-4S dicluster domain |