Result : C0H3W2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Spore germination protein-like protein YdzR |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 599875 |
| Right | 600105 |
| Strand | - |
| Nucleotide Sequence | ATGATGAAATTCCCAGTTTATATTCATTCGATATCCGGGAACAGCGTTTTTAATAACGGATTTGCAGTTTCCATCAGCCCGTTCTCTGTGTCTAAAACAACAGAGGGTTCCGGTGGGAGTAATACAGGTTTGGTTTTTGAATCCAATGCTTTAAGCCAAACAAGCTCCGCCAATCAAGCCCAAAATGTAACATATGCGATCCAAGAGCTGCTTTCCAAGCTTTTAGCGTAA |
| Sequence | MMKFPVYIHSISGNSVFNNGFAVSISPFSVSKTTEGSGGSNTGLVFESNALSQTSSANQAQNVTYAIQELLSKLLA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10676. Profile Description: Spore germination protein gerPA/gerPF. This is a bacterial family of proteins that are required for the formation of functionally normal spores. Proteins in this family may be involved in establishing normal coat structure and/or permeability which could control the access of germinants to their receptor. |
| Pubmed ID | 9384377 |
| Domain | CDD:371190 |
| Functional Category | Others |
| Uniprot ID | C0H3W2 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 599875 | 600105 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 575458 | 575697 | - | NZ_CP048852.1 | Bacillus tequilensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07681.14 | 1.0 | 2 | 1853.0 | opposite-strand | DoxX |
| 2 | PF10676.11 | 1.0 | 2 | 2083.5 | same-strand | Spore germination protein gerPA/gerPF |
| 3 | PF04239.14 | 1.0 | 2 | 520.0 | both-strands | Protein of unknown function (DUF421) |
| 4 | PF00011.23 | 1.0 | 2 | 1639.5 | same-strand | Hsp20/alpha crystallin family |
++ More..