Result : C0H3W1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YdzQ |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 587333 |
| Right | 587476 |
| Strand | - |
| Nucleotide Sequence | TTGAAATCGATTGATCTCACAATTTTATCATTAAAGAGAAAAGGAATCCGGACCGAAAAGGTATTAAAAAATCAGAACCCTGATCGATTAAGCCATATGACAGACAAAAATGCGCAACCAAAAAGCAAGGAAAAAGAGGAATGA |
| Sequence | MKSIDLTILSLKRKGIRTEKVLKNQNPDRLSHMTDKNAQPKSKEKEE |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H3W1 |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 587333 | 587476 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 540007 | 540156 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 563689 | 563838 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 562552 | 562722 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 738661 | 738831 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 4093468 | 4093638 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00155.23 | 0.83 | 5 | 2256 | opposite-strand | Aminotransferase class I and II |
| 2 | PF00392.23 | 0.83 | 5 | 2256 | opposite-strand | Bacterial regulatory proteins, gntR family |
| 3 | PF01613.20 | 0.67 | 4 | 1547.5 | same-strand | Flavin reductase like domain |
| 4 | PF12840.9 | 0.67 | 4 | 777.5 | opposite-strand | Helix-turn-helix domain |
| 5 | PF01022.22 | 0.67 | 4 | 777.5 | opposite-strand | Bacterial regulatory protein, arsR family |
| 6 | PF02627.22 | 0.67 | 4 | 262.5 | same-strand | Carboxymuconolactone decarboxylase family |
| 7 | PF07730.15 | 1.0 | 6 | 298.5 | opposite-strand | Histidine kinase |
| 8 | PF02518.28 | 1.0 | 6 | 298.5 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 9 | PF00072.26 | 1.0 | 6 | 1480.0 | opposite-strand | Response regulator receiver domain |
| 10 | PF00196.21 | 1.0 | 6 | 1480.0 | opposite-strand | Bacterial regulatory proteins, luxR family |
| 11 | PF03176.17 | 0.83 | 5 | 2241 | opposite-strand | MMPL family |
| 12 | PF12349.10 | 0.83 | 5 | 2241 | opposite-strand | Sterol-sensing domain of SREBP cleavage-activation |
| 13 | PF04474.14 | 0.67 | 4 | 4881.0 | same-strand | Protein of unknown function (DUF554) |
++ More..