Result : C0H3W0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YdzP |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 587157 |
| Right | 587336 |
| Strand | - |
| Nucleotide Sequence | ATGAACATGTATTGGTTTCTAGGTGCTTTATTATATTTTCTGATCGGTACTTATATATTCATTAGAGTCACTAGAGACAGCCAATCAGGCTCATGGATACTGCTTGCATTAGCAGCTCCACTCATCATTGCTGGCTACCCTTATTTTTATTCAAAGAAGCTTCTTTCCAAAAGACGCTGA |
| Sequence | MNMYWFLGALLYFLIGTYIFIRVTRDSQSGSWILLALAAPLIIAGYPYFYSKKLLSKRR |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H3W0 |
| ORF Length (Amino Acid) | 59 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 587157 | 587336 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 539834 | 540010 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 562379 | 562555 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 563516 | 563692 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 522670 | 522840 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 4093295 | 4093471 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 7 | 3888132 | 3888308 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 8 | 3996584 | 3996730 | + | NZ_CP051464.1 | Bacillus mojavensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01022.22 | 0.71 | 5 | 609 | opposite-strand | Bacterial regulatory protein, arsR family |
| 2 | PF07730.15 | 1.0 | 7 | 479 | opposite-strand | Histidine kinase |
| 3 | PF02518.28 | 1.0 | 7 | 479 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 4 | PF00072.26 | 1.0 | 7 | 1635 | opposite-strand | Response regulator receiver domain |
| 5 | PF00196.21 | 1.0 | 7 | 1634.5 | opposite-strand | Bacterial regulatory proteins, luxR family |
| 6 | PF03176.17 | 1.0 | 7 | 2398 | opposite-strand | MMPL family |
| 7 | PF12349.10 | 1.0 | 7 | 2398 | opposite-strand | Sterol-sensing domain of SREBP cleavage-activation |
++ More..