Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized membrane protein YdzN |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 557873 |
Right | 558058 |
Strand | + |
Nucleotide Sequence | TTGCGTTGGAGTAAATGGTTCAATGTTTTTTGTATAGTAGCATTGGGATCAATATATGGTTATAAATTATTTACTAACCAAGAAGTCAGTACTACTCGTTTAATAATAGCTTCTGTAATTGTGTTGTGGAATATTGTTGGACTTTTTAGCAAAGAATCAGTAAAACAAGCACAGCAAGCAAATTAA |
Sequence | MRWSKWFNVFCIVALGSIYGYKLFTNQEVSTTRLIIASVIVLWNIVGLFSKESVKQAQQAN |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | C0H3V7 |
ORF Length (Amino Acid) | 61 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 557873 | 558058 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 550178 | 550363 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
3 | 3406363 | 3406548 | - | NZ_CP011937.1 | Bacillus velezensis |
4 | 574412 | 574594 | + | NZ_CP048852.1 | Bacillus tequilensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07883.13 | 0.75 | 3 | 3456 | opposite-strand | Cupin domain |
2 | PF01545.23 | 0.75 | 3 | 3003 | same-strand | Cation efflux family |
3 | PF16916.7 | 0.75 | 3 | 3003 | same-strand | Dimerisation domain of Zinc Transporter |