Result : C0H3V4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YdzK |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 490777 |
| Right | 491043 |
| Strand | - |
| Nucleotide Sequence | ATGTCAGTATTTATTCTGTTTTATTTGTGGATTGTTCCTATTGTTATCGGCATTTTATGTTCTGTTGCTGCCCATAAATCCAAGGGAAAAATGAGAGTCGCGCCCGGCATTGCCATGATCGTGCTCAGTATCATTTCCCTAATCACGGCGTTTACGGCCGGACACACAAATTTCCACGTGTTTATCGGCGGCATGTTTTTATTCGGCACCTTCTTGGTCGGTTCTGCTTTTCCTTTCTTCTTCGGGCTGAAGAAAAAAGAAAAATAA |
| Sequence | MSVFILFYLWIVPIVIGILCSVAAHKSKGKMRVAPGIAMIVLSIISLITAFTAGHTNFHVFIGGMFLFGTFLVGSAFPFFFGLKKKEK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H3V4 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 490777 | 491043 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 442789 | 443055 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 466889 | 467155 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 488071 | 488337 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 645995 | 646261 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 488976 | 489245 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 1520291 | 1520560 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 480645 | 480911 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 3469302 | 3469568 | + | NZ_CP011937.1 | Bacillus velezensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13520.8 | 0.67 | 6 | 2526.5 | opposite-strand | Amino acid permease |
| 2 | PF00293.30 | 0.67 | 6 | 2018.5 | opposite-strand | NUDIX domain |
| 3 | PF02776.20 | 0.89 | 8 | 249.0 | opposite-strand | Thiamine pyrophosphate enzyme, N-terminal TPP binding domain |
| 4 | PF02775.23 | 0.89 | 8 | 249.0 | opposite-strand | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain |
| 5 | PF00205.24 | 0.89 | 8 | 249.0 | opposite-strand | Thiamine pyrophosphate enzyme, central domain |
| 6 | PF01566.20 | 1.0 | 9 | 106 | same-strand | Natural resistance-associated macrophage protein |
| 7 | PF04226.15 | 0.78 | 7 | 1611 | same-strand | Transglycosylase associated protein |
| 8 | PF09954.11 | 0.78 | 7 | 1946 | same-strand | Uncharacterized protein conserved in bacteria (DUF2188) |
| 9 | PF12787.9 | 0.78 | 7 | 2516 | opposite-strand | EcsC protein family |
| 10 | PF10685.11 | 0.78 | 7 | 3463 | opposite-strand | Stress-induced bacterial acidophilic repeat motif |
++ More..