Protein Information |
Information Type | Description |
---|---|
Protein name | EXP03756 |
NCBI Accession ID | |
Organism | Roseburia,Fusicatenibacter |
Left | |
Right | |
Strand | |
Nucleotide Sequence | ATGGAATTTTTCAATCAGGCAATCGACATTCTTAAAATTCTGGTCATGGCTCTTGGCGCCGGTCTGGCGGTATGGGGCGTCATCAACCTTCTGGACGTGTGCTCTTCCGATCTGGTCGGACAACCCTGCGGCAAAAAGCCAGGGCATTAA |
Sequence | MEFFNQAIDILKILVMALGAGLAVWGVINLLDVCSSDLVGQPCGKKPGH |
Source of smORF | Metagenomic Ribo-seq |
Function | |
Pubmed ID | 32601270 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 49 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1255927 | 1256085 | + | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
2 | 750178 | 750336 | + | NZ_AP022822.1 | Enterococcus saigonensis |
3 | 1446883 | 1447041 | - | NZ_LT635480.1 | Ndongobacter massiliensis |
4 | 2756734 | 2756892 | + | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF12696.9 | 1.0 | 4 | 903.5 | same-strand | TraM recognition site of TraD and TraG |
2 | PF13443.8 | 1.0 | 4 | 136.5 | same-strand | Cro/C1-type HTH DNA-binding domain |