Result : EXP03756
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03756 |
| NCBI Accession ID | |
| Organism | Roseburia,Fusicatenibacter |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGAATTTTTCAATCAGGCAATCGACATTCTTAAAATTCTGGTCATGGCTCTTGGCGCCGGTCTGGCGGTATGGGGCGTCATCAACCTTCTGGACGTGTGCTCTTCCGATCTGGTCGGACAACCCTGCGGCAAAAAGCCAGGGCATTAA |
| Sequence | MEFFNQAIDILKILVMALGAGLAVWGVINLLDVCSSDLVGQPCGKKPGH |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1255927 | 1256085 | + | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
| 2 | 750178 | 750336 | + | NZ_AP022822.1 | Enterococcus saigonensis |
| 3 | 1446883 | 1447041 | - | NZ_LT635480.1 | Ndongobacter massiliensis |
| 4 | 2756734 | 2756892 | + | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP028107.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12696.9 | 1.0 | 4 | 903.5 | same-strand | TraM recognition site of TraD and TraG |
| 2 | PF13443.8 | 1.0 | 4 | 136.5 | same-strand | Cro/C1-type HTH DNA-binding domain |
++ More..