Result : C0H3V3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YczO |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 455771 |
| Right | 455935 |
| Strand | - |
| Nucleotide Sequence | ATGACAGAAAAAAAACAGCAAAACAAACCAAATGAAAACCCCGAGCACAACGACTTAACCGATCCGATTCCTAATGAAGAGCTGAAGGAAAATATGAATGATGAAAAACACAAACGCCAGCAAAGAGATAACTCTCAAAGCGAACGGGATTACGACACAAAATAG |
| Sequence | MTEKKQQNKPNENPEHNDLTDPIPNEELKENMNDEKHKRQQRDNSQSERDYDTK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H3V3 |
| ORF Length (Amino Acid) | 54 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 455771 | 455935 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 407711 | 407875 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 431812 | 431976 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 610005 | 610169 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 453073 | 453237 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 6 | 453438 | 453602 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 1555997 | 1556161 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 3509800 | 3509964 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 444094 | 444258 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP048852.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00180.22 | 0.78 | 7 | 1854 | opposite-strand | Isocitrate/isopropylmalate dehydrogenase |
| 2 | PF10502.11 | 0.67 | 6 | 1168.0 | opposite-strand | Signal peptidase, peptidase S26 |
| 3 | PF07977.15 | 1.0 | 9 | 36 | opposite-strand | FabA-like domain |
| 4 | PF05116.15 | 1.0 | 9 | 133 | opposite-strand | Sucrose-6F-phosphate phosphohydrolase |
| 5 | PF03746.18 | 1.0 | 9 | 1087 | opposite-strand | LamB/YcsF family |
| 6 | PF01566.20 | 1.0 | 9 | 1873 | opposite-strand | Natural resistance-associated macrophage protein |
| 7 | PF07286.14 | 1.0 | 9 | 3093 | opposite-strand | Protein of unknown function (DUF1445) |
| 8 | PF02682.18 | 0.89 | 8 | 3929.5 | opposite-strand | Carboxyltransferase domain, subdomain C and D |
| 9 | PF08125.15 | 0.67 | 6 | 2286.5 | opposite-strand | Mannitol dehydrogenase C-terminal domain |
| 10 | PF01232.25 | 0.67 | 6 | 2286.5 | opposite-strand | Mannitol dehydrogenase Rossmann domain |
++ More..