Protein Information |
Information Type | Description |
---|---|
Protein name | Protein BsdD (Phenolic acid decarboxylase subunit D) (PAD) |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 414595 |
Right | 414822 |
Strand | + |
Nucleotide Sequence | ATGCATACATGTCCTCGATGCGACTCAAAAAAGGGAGAAGTCATGAGCAAATCGCCTGTAGAAGGCGCATGGGAAGTTTATCAGTGCCAAACATGCTTTTTTACATGGAGATCCTGTGAACCGGAAAGCATTACAAATCCCGAAAAATACAATCCAGCGTTTAAAATTGATCCAAAGGAAACAGAAACAGCAATTGAAGTTCCGGCGGTGCCGGAACGAAAGGCTTGA |
Sequence | MHTCPRCDSKKGEVMSKSPVEGAWEVYQCQTCFFTWRSCEPESITNPEKYNPAFKIDPKETETAIEVPAVPERKA |
Source of smORF | Swiss-Prot |
Function | Involved in the non-oxidative decarboxylation and detoxification of phenolic derivatives under both aerobic and anaerobic conditions, however the precise biochemical function of BsdD in metabolism of phenolic acid is unknown. {ECO:0000269|Pubmed:18388975}. |
Pubmed ID | 8969502 9384377 17295427 18388975 26658822 |
Domain | |
Functional Category | Others |
Uniprot ID | C0H3U9 |
ORF Length (Amino Acid) | 75 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 414595 | 414822 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1596469 | 1596696 | - | NZ_CP029364.1 | Bacillus halotolerans |
3 | 367496 | 367723 | + | NZ_CP013984.1 | Bacillus inaquosorum |
4 | 413012 | 413239 | + | NZ_CP051464.1 | Bacillus mojavensis |
5 | 395433 | 395660 | + | NZ_CP048852.1 | Bacillus tequilensis |
6 | 412046 | 412273 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
7 | 571100 | 571327 | + | NZ_CP033052.1 | Bacillus vallismortis |
8 | 3554184 | 3554411 | - | NZ_CP011937.1 | Bacillus velezensis |
9 | 471715 | 471942 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
10 | 399640 | 399867 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
11 | 428239 | 428466 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
12 | 484961 | 485188 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
13 | 2601478 | 2601702 | - | NZ_CP024035.1 | Priestia aryabhattai |
14 | 5180870 | 5181106 | - | NZ_CP020028.1 | Paenibacillus kribbensis |
15 | 2709333 | 2709569 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
16 | 2079585 | 2079821 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
17 | 80970 | 81197 | + | NZ_CP013023.1 | Paenibacillus bovis |
18 | 1249490 | 1249678 | + | NZ_CP013114.1 | Staphylococcus equorum |
19 | 1984125 | 1984316 | - | NZ_CP065640.1 | Serratia rubidaea |
20 | 2549824 | 2550012 | + | NZ_CP043998.1 | Clostridium diolis |
21 | 2361476 | 2361667 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
22 | 1045844 | 1046041 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
23 | 2235418 | 2235615 | + | NZ_CP026377.1 | Mixta gaviniae |
24 | 4201988 | 4202185 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
25 | 1047488 | 1047685 | + | NZ_CP054254.1 | Klebsiella variicola |
26 | 4544874 | 4545062 | + | NZ_CP049115.1 | Pantoea stewartii |
27 | 3240274 | 3240471 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
28 | 597439 | 597636 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03466.22 | 0.86 | 24 | 2150.0 | opposite-strand | LysR substrate binding domain |
2 | PF00126.29 | 0.86 | 24 | 2150.0 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
3 | PF01977.18 | 1.0 | 28 | 40.0 | same-strand | 3-octaprenyl-4-hydroxybenzoate carboxy-lyase |