Result : EXP03713
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03713 |
| NCBI Accession ID | |
| Organism | Gabonibacter |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAAAAAAAAGAGTTATAAAATCTGGCAAGTCATCGGCGTTATCATCGCCATCGTTTTATTGATATACTGGCTATTAGCCGTAACCGTCTTAGAGGAAGACGAGAACGTCATCCCCGTGTTAGACGGCACGGAACAAACCACCTTCTAA |
| Sequence | MKKKSYKIWQVIGVIIAIVLLIYWLLAVTVLEEDENVIPVLDGTEQTTF |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4621768 | 4621917 | + | NZ_CP069450.1 | Butyricimonas virosa |
| 2 | 4052566 | 4052715 | - | NZ_CP032819.1 | Butyricimonas faecalis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP069450.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02127.17 | 1.0 | 2 | 1079.0 | opposite-strand | Aminopeptidase I zinc metalloprotease (M18) |
| 2 | PF00459.27 | 1.0 | 2 | 1079.0 | opposite-strand | Inositol monophosphatase family |
| 3 | PF02152.20 | 1.0 | 2 | 302.0 | same-strand | Dihydroneopterin aldolase |
| 4 | PF07681.14 | 1.0 | 2 | 18.5 | opposite-strand | DoxX |
| 5 | PF03956.15 | 1.0 | 2 | 870.0 | same-strand | Lysine exporter LysO |
++ More..