Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized membrane protein YyzH |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 4166815 |
Right | 4166964 |
Strand | - |
Nucleotide Sequence | ATGTGGGACATGATAAAGAACTTTTTCTTGTTTAGCAGCGGCGTTCTGCAAGCAACAACCCTTTTACTGGTGATCTTAATTTTTATGTATGTCAGAAAAACGAAAAAGAAAAACAAGGAATCTTCTGGCTTTATGGATGATAAACATTAA |
Sequence | MWDMIKNFFLFSSGVLQATTLLLVILIFMYVRKTKKKNKESSGFMDDKH |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | C0H3U2 |
ORF Length (Amino Acid) | 49 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4166815 | 4166964 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 3961370 | 3961519 | - | NZ_CP048852.1 | Bacillus tequilensis |
3 | 90652 | 90801 | - | NZ_CP033052.1 | Bacillus vallismortis |
4 | 4069532 | 4069681 | - | NZ_CP013984.1 | Bacillus inaquosorum |
5 | 4006824 | 4006973 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
6 | 2076157 | 2076306 | + | NZ_CP029364.1 | Bacillus halotolerans |
7 | 3977018 | 3977167 | - | NZ_CP051464.1 | Bacillus mojavensis |
8 | 49788 | 49940 | + | NZ_CP011937.1 | Bacillus velezensis |
9 | 3978309 | 3978461 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
10 | 4202622 | 4202750 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
11 | 6648 | 6788 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
12 | 4587218 | 4587358 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03948.16 | 1.0 | 12 | 3168.5 | same-strand | Ribosomal protein L9, C-terminal domain |
2 | PF01281.21 | 1.0 | 12 | 3168.5 | same-strand | Ribosomal protein L9, N-terminal domain |
3 | PF01368.22 | 1.0 | 12 | 1210 | same-strand | DHH family |
4 | PF02272.21 | 1.0 | 12 | 1192.5 | same-strand | DHHA1 domain |
5 | PF09991.11 | 1.0 | 12 | 227.0 | same-strand | Predicted membrane protein (DUF2232) |
6 | PF07875.14 | 0.92 | 11 | 146 | opposite-strand | Coat F domain |
7 | PF01638.19 | 0.75 | 9 | 657 | same-strand | HxlR-like helix-turn-helix |
8 | PF02833.16 | 0.75 | 9 | 1240 | opposite-strand | DHHA2 domain |