Result : C0H3U0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YyzG |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 4137087 |
| Right | 4137257 |
| Strand | - |
| Nucleotide Sequence | ATGCAGACAAATCGGGTTATTCTTCTGGCAGTTATGATCTGCCTGGTTTCGGCCATTACTGTGTTCTTGTTAAATGGATGTAAAGTCGACTTCTTAGACATCGGCGGAACCATTATTGGATGCTTTCTTGGCATATTTGTTGTTGTAAGAATACAGAAAAAACAGTCGTGA |
| Sequence | MQTNRVILLAVMICLVSAITVFLLNGCKVDFLDIGGTIIGCFLGIFVVVRIQKKQS |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H3U0 |
| ORF Length (Amino Acid) | 56 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4137087 | 4137257 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 4036372 | 4036542 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 3933818 | 3933988 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 3949318 | 3949488 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 5 | 2105871 | 2106041 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 3977138 | 3977308 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 7 | 63320 | 63490 | - | NZ_CP033052.1 | Bacillus vallismortis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02590.19 | 1.0 | 7 | 2172 | same-strand | Predicted SPOUT methyltransferase |
| 2 | PF14116.8 | 1.0 | 7 | 1921 | same-strand | YyzF-like protein |
| 3 | PF08240.14 | 0.86 | 6 | 78.0 | same-strand | Alcohol dehydrogenase GroES-like domain |
| 4 | PF13302.9 | 0.71 | 5 | 2521 | same-strand | Acetyltransferase (GNAT) domain |
| 5 | PF18801.3 | 1.0 | 7 | 3100 | opposite-strand | response regulator aspartate phosphatase H, N terminal |
| 6 | PF13424.8 | 1.0 | 7 | 3100 | opposite-strand | Tetratricopeptide repeat |
++ More..