Result : C0H3T9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YyzF |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 4134996 |
| Right | 4135166 |
| Strand | - |
| Nucleotide Sequence | ATGAAACAAGCGTATTATTCTTGTGAAGAACACATCGAAACGGTGCTGGATATGTACATAGACGACCACGAGCTGCCGCCCGAAATCAGAAAAATCGAACATACTAACAGTTTATCCACAGCCTGTGAATTATGTGGAGACCCCGCAGTATATATAGTGGGGAACGAATGA |
| Sequence | MKQAYYSCEEHIETVLDMYIDDHELPPEIRKIEHTNSLSTACELCGDPAVYIVGNE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl15733. Profile Description: YyzF-like protein. Members of this protein family occur exclusively in the Firmicutes, in at least 50 different species. Members average about 55 residues in length, and four of the five invariant or nearly invariant residues occur in motifs CxxH and CxxC. The function is unknown. |
| Pubmed ID | 9384377 |
| Domain | CDD:417763 |
| Functional Category | Others |
| Uniprot ID | C0H3T9 |
| ORF Length (Amino Acid) | 56 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3976286 | 3976456 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 2 | 4134996 | 4135166 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 61213 | 61383 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 3947228 | 3947398 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 5 | 4034281 | 4034451 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 6 | 2107962 | 2108132 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 3931729 | 3931899 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 92846 | 93016 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 3936330 | 3936500 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 1622932 | 1623102 | + | NZ_CP043404.1 | Bacillus safensis |
| 11 | 1702802 | 1702972 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 12 | 3682487 | 3682657 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 13 | 4176381 | 4176539 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 14 | 4357387 | 4357545 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 15 | 4562084 | 4562242 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 16 | 4231472 | 4231627 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 998301 | 998456 | - | NZ_CP017703.1 | Aeribacillus pallidus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP034943.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02590.19 | 1.0 | 17 | 81 | same-strand | Predicted SPOUT methyltransferase |
++ More..