Result : EXP03676
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03676 |
| NCBI Accession ID | |
| Organism | Lachnoclostridium,Clostridium |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGATGGATTGGTGCAGACAGAATAAGATGGCGGTTATCCTTCTTGTTCTTGGCATAGTATTCCTGTGCACCGGAGCCGCCCAGGGAGGTTACCAGGATGCCTTCCGCAAGGCAGTGAGGGTGTGCCTGGAATGCATCGGAATCGGATAA |
| Sequence | MMDWCRQNKMAVILLVLGIVFLCTGAAQGGYQDAFRKAVRVCLECIGIG |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 674350 | 674499 | + | NZ_CP022464.2 | Enterocloster bolteae |
| 2 | 2090279 | 2090425 | - | NC_015385.1 | Treponema succinifaciens DSM 2489 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP022464.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08534.12 | 1.0 | 2 | 11.0 | same-strand | Redoxin |
| 2 | PF13905.8 | 1.0 | 2 | 11.0 | same-strand | Thioredoxin-like |
| 3 | PF12801.9 | 1.0 | 2 | 30.0 | same-strand | 4Fe-4S binding domain |
++ More..