Result : C0H3T8

Protein Information

• Protein name: Uncharacterized membrane protein YyzN
• NCBI Accession ID: AL009126.3
• Organism: Bacillus subtilis (strain 168)
• Left: 4123931
• Right: 4124089
• Strand: +
• Nucleotide Sequence: ATGTACAAAATTATCATTCCTGCCATACTAGCCATCTTTGCGCTCTGGATACTCTTACAGATTTCACTAGAGATGAGCATCGTTAAGAATCCAATGAACTACTTTATCGTATTCATTATCTTTTTCCTCTTTGTAAAGATGGTGAAAGAAAAACAATAA
• Sequence: MYKIIIPAILAIFALWILLQISLEMSIVKNPMNYFIVFIIFFLFVKMVKEKQ
• Source of smORF: Swiss-Prot
• Pubmed ID: 9384377
• Functional Category: Others
• Uniprot ID: C0H3T8
• ORF Length (Amino Acid): 52

Conservation Analysis

No. of Species: 11

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	4123931	4124089	+	NC_000964.3	Bacillus subtilis subsp. subtilis str. 168
2	3926378	3926539	+	NZ_CP048852.1	Bacillus tequilensis
3	3962528	3962692	+	NZ_CP034943.1	Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499
4	1009635	1009796	+	NZ_CP008876.1	Terribacillus goriensis
5	3538040	3538195	-	NZ_CP024035.1	Priestia aryabhattai
6	2117906	2118064	-	NZ_CP029364.1	Bacillus halotolerans
7	100307	100468	-	NZ_CP011937.1	Bacillus velezensis
8	47826	47981	+	NZ_CP033052.1	Bacillus vallismortis
9	271188	271343	+	NZ_CP023665.1	Bacillus paralicheniformis
10	1657147	1657308	-	NZ_CP043404.1	Bacillus safensis
11	3654941	3655072	+	NZ_CP011150.1	Bacillus altitudinis

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000964.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00392.23	0.64	7	69	same-strand	Bacterial regulatory proteins, gntR family