| Protein name |
EXP03671 |
| NCBI Accession ID |
|
| Organism |
Peptoanaerobacter |
| Left |
|
| Right |
|
| Strand |
|
| Nucleotide Sequence |
GTGTTTATCATTAAAAGCTGGAAATGTACAATATGTGGCTATATTCATGATGGAGAAACTCCACCGGAGAAATGTCCGATATGTGGTTATGGACCTGAAAAATTTATGCAAATAGCCAATTATAAAAAAAATAACAAGGATAATAAATAG |
| Sequence |
MFIIKSWKCTICGYIHDGETPPEKCPICGYGPEKFMQIANYKKNNKDNK |
| Source of smORF |
Metagenomic Ribo-seq |
| Function |
The ORF matches to the profile of cl00202. Profile Description: N/A. Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer. |
| Pubmed ID |
32601270
|
| Domain |
CDD:412217 |
| Functional Category |
Conserved domain based functional assignment |
| Uniprot ID |
|
| ORF Length (Amino Acid) |
49 |