Protein name |
EXP03671 |
NCBI Accession ID |
|
Organism |
Peptoanaerobacter |
Left |
|
Right |
|
Strand |
|
Nucleotide Sequence |
GTGTTTATCATTAAAAGCTGGAAATGTACAATATGTGGCTATATTCATGATGGAGAAACTCCACCGGAGAAATGTCCGATATGTGGTTATGGACCTGAAAAATTTATGCAAATAGCCAATTATAAAAAAAATAACAAGGATAATAAATAG |
Sequence |
MFIIKSWKCTICGYIHDGETPPEKCPICGYGPEKFMQIANYKKNNKDNK |
Source of smORF |
Metagenomic Ribo-seq |
Function |
The ORF matches to the profile of cl00202. Profile Description: N/A. Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer. |
Pubmed ID |
32601270
|
Domain |
CDD:412217 |
Functional Category |
Conserved domain based functional assignment |
Uniprot ID |
|
ORF Length (Amino Acid) |
49 |