| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03647 |
| NCBI Accession ID | |
| Organism | Escherichia,Eisenbergiella |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGTGGTATTTACTTTGGTTCGTCGGCATTTTGTTGATGTGTTCGCTCTCCACCCTTGTGTTGGTATGGCTGGACCCGCGTCTGAAAAGTTAA |
| Sequence | MWYLLWFVGILLMCSLSTLVLVWLDPRLKS |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of PRK14749. Profile Description: cytochrome bd-II oxidase subunit CbdX. |
| Pubmed ID | 32601270 |
| Domain | CDD:173210 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | P24244 |
| ORF Length (Amino Acid) | 30 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1219707 | 1219799 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 1040445 | 1040537 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1028871 | 1028963 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 2709643 | 2709735 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 1188309 | 1188398 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 6 | 3287279 | 3287368 | - | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 7 | 1052106 | 1052198 | + | NZ_AP014857.1 | Escherichia albertii |
| 8 | 1707253 | 1707345 | + | NZ_LR134340.1 | Escherichia marmotae |
| 9 | 2221247 | 2221336 | + | NZ_CP023706.1 | Edwardsiella tarda |
| 10 | 508385 | 508474 | + | NZ_CP016043.1 | Edwardsiella hoshinae |
| 11 | 4403775 | 4403864 | + | NZ_CP053416.1 | Salmonella bongori |
| 12 | 1893092 | 1893181 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 13 | 1317725 | 1317814 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 14 | 2367711 | 2367800 | + | NZ_CP038469.1 | Citrobacter tructae |
| 15 | 3793844 | 3793933 | - | NZ_CP033744.1 | Citrobacter freundii |
| 16 | 2944069 | 2944155 | - | NZ_CP035492.1 | Paenibacillus protaetiae |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07449.13 | 0.93 | 14 | 3693 | same-strand | Hydrogenase-1 expression protein HyaE |
| 2 | PF04809.15 | 0.93 | 14 | 2840.0 | same-strand | HupH hydrogenase expression protein, C-terminal conserved region |
| 3 | PF01654.19 | 0.93 | 14 | 1161 | same-strand | Cytochrome bd terminal oxidase subunit I |
| 4 | PF02322.17 | 0.93 | 14 | 13 | same-strand | Cytochrome bd terminal oxidase subunit II |