Result : C0H3T3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YwzH |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3952108 |
| Right | 3952257 |
| Strand | + |
| Nucleotide Sequence | ATGCTGCAATTAATGAAACAGCTGTATGAAAAACCCGCTGTCAAGTGGACATGTCATACAGGCTTTTATTTGATGATACTGCTTGTTTTGTTTTTTATGTATGGTTTTCACACCGCGAATACCGGTTCATATATTTATAACGATTTCTAA |
| Sequence | MLQLMKQLYEKPAVKWTCHTGFYLMILLVLFFMYGFHTANTGSYIYNDF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam12459. Profile Description: D-Ala-teichoic acid biosynthesis protein. This family of proteins is found in bacteria. Proteins in this family are approximately 50 amino acids in length. There are two completely conserved residues (L and Y) that may be functionally important. |
| Pubmed ID | 9384377 |
| Domain | CDD:403604 |
| Functional Category | Others |
| Uniprot ID | C0H3T3 |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3840042 | 3840191 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 2 | 3779557 | 3779706 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 3952108 | 3952257 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 4 | 2284514 | 2284663 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 3767091 | 3767240 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 3834511 | 3834660 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 3774544 | 3774693 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 3792222 | 3792371 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 247992 | 248141 | - | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 510650 | 510796 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 11 | 29849 | 29977 | - | NZ_CP053989.1 | Niallia circulans |
| 12 | 4108778 | 4108927 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 13 | 3903799 | 3903948 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 14 | 4369809 | 4369958 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 15 | 2524349 | 2524492 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 16 | 2780333 | 2780476 | + | NZ_CP043404.1 | Bacillus safensis |
| 17 | 2868042 | 2868185 | + | NZ_CP017786.1 | Bacillus xiamenensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013984.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04607.19 | 0.71 | 12 | 1519.5 | opposite-strand | Region found in RelA / SpoT proteins |
| 2 | PF00501.30 | 1.0 | 17 | 16 | same-strand | AMP-binding enzyme |
| 3 | PF13193.8 | 1.0 | 17 | 16 | same-strand | AMP-binding enzyme C-terminal domain |
| 4 | PF00550.27 | 1.0 | 17 | 2723 | same-strand | Phosphopantetheine attachment site |
| 5 | PF04914.14 | 1.0 | 17 | 2959 | same-strand | DltD protein |
++ More..