Result : EXP03642
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03642 |
| NCBI Accession ID | |
| Organism | |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGCCCGGGAAGGGAGGGGAGCCCATGAAGATGGTGGTGGTGAGCGCACCCAAAGCCTTGGCAGGCTTGCTGAAAAAGCTCTTCCATATTTGA |
| Sequence | MPGKGGEPMKMVVVSAPKALAGLLKKLFHI |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 30 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1411350 | 1411430 | + | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 2 | 57657 | 57731 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
| 3 | 2320768 | 2320845 | - | NZ_CP048436.1 | Flavonifractor plautii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP048436.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04055.23 | 1.0 | 3 | 4262 | same-strand | Radical SAM superfamily |
| 2 | PF13672.8 | 1.0 | 3 | 3496 | same-strand | Protein phosphatase 2C |
| 3 | PF07228.14 | 0.67 | 2 | 3695.0 | same-strand | Stage II sporulation protein E (SpoIIE) |
| 4 | PF00069.27 | 1.0 | 3 | 1617 | same-strand | Protein kinase domain |
| 5 | PF07714.19 | 1.0 | 3 | 1617 | same-strand | Protein tyrosine and serine/threonine kinase |
| 6 | PF03793.21 | 1.0 | 3 | 1617 | same-strand | PASTA domain |
| 7 | PF03193.18 | 1.0 | 3 | 726 | same-strand | RsgA GTPase |
| 8 | PF16745.7 | 1.0 | 3 | 726 | same-strand | RsgA N-terminal domain |
| 9 | PF04263.18 | 0.67 | 2 | 155.0 | same-strand | Thiamin pyrophosphokinase, catalytic domain |
| 10 | PF12673.9 | 1.0 | 3 | 121 | same-strand | Domain of unknown function (DUF3794) |
| 11 | PF01476.22 | 0.67 | 2 | 134.5 | same-strand | LysM domain |
++ More..