Result : C0H3T2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YczK |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 283816 |
| Right | 283992 |
| Strand | + |
| Nucleotide Sequence | ATGGGCGGCTTGCAAACGACAGGATATGCAGAAAACGCGTCATTCAGCCAGCTTTCGGCATGTTTCAGCAGCAGGCTTGTGAGGGAAGACCTGTTTTTAATGTTCAGCGCTTACAATCAGTTCACACTTCTTCACAGTCGTTTAACAATGATTTCCTATAATGGAGACGATCAATGA |
| Sequence | MGGLQTTGYAENASFSQLSACFSSRLVREDLFLMFSAYNQFTLLHSRLTMISYNGDDQ |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H3T2 |
| ORF Length (Amino Acid) | 58 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 283816 | 283992 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 267839 | 268015 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 282918 | 283094 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12730.9 | 0.67 | 2 | 2660.0 | same-strand | ABC-2 family transporter protein |
| 2 | PF10710.11 | 1.0 | 3 | 1812 | opposite-strand | Protein of unknown function (DUF2512) |
| 3 | PF07486.14 | 1.0 | 3 | 917 | same-strand | Cell Wall Hydrolase |
| 4 | PF10138.11 | 0.67 | 2 | 81.0 | same-strand | vWA found in TerF C terminus |
| 5 | PF09423.12 | 1.0 | 3 | 19 | same-strand | PhoD-like phosphatase |
| 6 | PF16655.7 | 1.0 | 3 | 19 | same-strand | PhoD-like phosphatase, N-terminal domain |
| 7 | PF16656.7 | 1.0 | 3 | 19 | same-strand | Purple acid Phosphatase, N-terminal domain |
| 8 | PF02416.18 | 1.0 | 3 | 1784 | same-strand | mttA/Hcf106 family |
| 9 | PF00902.20 | 1.0 | 3 | 2056 | same-strand | Sec-independent protein translocase protein (TatC) |
| 10 | PF01470.19 | 1.0 | 3 | 2780 | opposite-strand | Pyroglutamyl peptidase |
++ More..