Result : C0H3T1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YbzI |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 222971 |
| Right | 223234 |
| Strand | + |
| Nucleotide Sequence | GTGAACATCATATGTTTAAAAAAATCATCAAAACGATTAAGTACCTCTCAAGCAGTTCTAGTGACCGATATCGCAGACACCGGCATTACAGCAGCAGCCGGCGCAGACATTATCGCAGCTACAGCAGCAGTTCGGGCAAAAGAAGACACTACGACCGTTATGGCGGCAGTCATCGTTACAAACGCCGGAGCTACAGCAGCAGTTAATCCAAAAAAAGTTCTTGTTCCGCTTTTGGGACAAGGGTTTTTTTATGTGACCGATTGA |
| Sequence | MNIICLKKSSKRLSTSQAVLVTDIADTGITAAAGADIIAATAAVRAKEDTTTVMAAVIVTNAGATAAVNPKKVLVPLLGQGFFYVTD |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H3T1 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 222971 | 223234 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 218742 | 218996 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 224799 | 225035 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 358451 | 358681 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 1793860 | 1794123 | - | NZ_CP029364.1 | Bacillus halotolerans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00072.26 | 0.8 | 4 | 1042.0 | same-strand | Response regulator receiver domain |
| 2 | PF00486.30 | 0.8 | 4 | 1042.0 | same-strand | Transcriptional regulatory protein, C terminal |
| 3 | PF00512.27 | 0.8 | 4 | 59.0 | same-strand | His Kinase A (phospho-acceptor) domain |
| 4 | PF00672.27 | 0.8 | 4 | 59.0 | same-strand | HAMP domain |
| 5 | PF16226.7 | 0.8 | 4 | 1849.5 | same-strand | Domain of unknown function (DUF4885) |
| 6 | PF00324.23 | 1.0 | 5 | 3332 | same-strand | Amino acid permease |
| 7 | PF13520.8 | 1.0 | 5 | 3332 | same-strand | Amino acid permease |
| 8 | PF17334.4 | 0.8 | 4 | 4796.5 | same-strand | Minor curli fiber component A |
++ More..