Result : EXP03622
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03622 |
| NCBI Accession ID | |
| Organism | Prevotella |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGTAATCACCATTGGAGAGATGGTAGAGTGGTCGATTACAGCGGTCTTGAAAACCGCCGTGCTGAGAGGCACCGGGGGTTCGAATCCCTCTCTCTCCGCTAATAGGTACTCTGAACAGACCAACAGAGAAATCCTAACAAAAACGTAA |
| Sequence | MVITIGEMVEWSITAVLKTAVLRGTGGSNPSLSANRYSEQTNREILTKT |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1427070 | 1427207 | - | NZ_LR134384.1 | Prevotella oris |
| 2 | 1628840 | 1628974 | - | NZ_CP047897.1 | Nibribacter ruber |
| 3 | 2347545 | 2347676 | + | NZ_CP024091.1 | Pedobacter ginsengisoli |
| 4 | 134708 | 134839 | + | NZ_CP033926.1 | Chryseobacterium joostei |
| 5 | 5240293 | 5240430 | + | NZ_LR590484.1 | Sphingobacterium thalpophilum |
| 6 | 7391449 | 7391577 | - | NZ_CP048113.1 | Chitinophaga agri |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134384.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02518.28 | 0.83 | 5 | 4087 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
++ More..