Protein Information |
Information Type | Description |
---|---|
Protein name | Putative ribosome-binding protein YbzG |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 147312 |
Right | 147536 |
Strand | + |
Nucleotide Sequence | TTGATAGGGCAGAAAGCTTGGGTGAACATTGGCAAGACCGAATTCATCTTGCTTCTTGTCGTTGGAATTTTAACCATCATCAATGTACTAACAGCAGACGGAGAAAAGCGTACATTTCATTCTCCTAAGAAAAAGAATATCAATCATTTAACCCTTTATGATTGCGTATCTCCGGAAGTTCAGAACAGTATAAACGAAACAGGGCGTGTGACAAACTTCTTTTGA |
Sequence | MIGQKAWVNIGKTEFILLLVVGILTIINVLTADGEKRTFHSPKKKNINHLTLYDCVSPEVQNSINETGRVTNFF |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00354. Profile Description: KOW: an acronym for the authors' surnames (Kyrpides, Ouzounis and Woese). Ribosomal_L26 is a family of the 50S and the 60S ribosomal proteins from eukaryotes - L26 - and archaea - L25. |
Pubmed ID | 9384377 19383706 |
Domain | CDD:412330 |
Functional Category | Others |
Uniprot ID | C0H3S8 |
ORF Length (Amino Acid) | 74 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 147312 | 147536 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 147137 | 147361 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
3 | 117032 | 117256 | + | NZ_CP013984.1 | Bacillus inaquosorum |
4 | 147251 | 147475 | + | NZ_CP048852.1 | Bacillus tequilensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00327.22 | 1.0 | 4 | 3257.5 | same-strand | Ribosomal protein L30p/L7e |
2 | PF00828.21 | 1.0 | 4 | 2786.5 | same-strand | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A |
3 | PF00344.22 | 1.0 | 4 | 1489.5 | same-strand | SecY |
4 | PF00406.24 | 1.0 | 4 | 782.0 | same-strand | Adenylate kinase |
5 | PF13207.8 | 1.0 | 4 | 782.0 | same-strand | AAA domain |
6 | PF05191.16 | 1.0 | 4 | 782.0 | same-strand | Adenylate kinase, active site lid |
7 | PF13671.8 | 1.0 | 4 | 782.0 | same-strand | AAA domain |
8 | PF00557.26 | 1.0 | 4 | 38.5 | same-strand | Metallopeptidase family M24 |
9 | PF01176.21 | 1.0 | 4 | 49.0 | same-strand | Translation initiation factor 1A / IF-1 |
10 | PF00444.20 | 1.0 | 4 | 301.0 | same-strand | Ribosomal protein L36 |
11 | PF00416.24 | 1.0 | 4 | 437.0 | same-strand | Ribosomal protein S13/S18 |
12 | PF00411.21 | 1.0 | 4 | 823.0 | same-strand | Ribosomal protein S11 |
13 | PF03118.17 | 1.0 | 4 | 1395.0 | same-strand | Bacterial RNA polymerase, alpha chain C terminal domain |
14 | PF01000.28 | 1.0 | 4 | 1395.0 | same-strand | RNA polymerase Rpb3/RpoA insert domain |
15 | PF01193.26 | 1.0 | 4 | 1395.0 | same-strand | RNA polymerase Rpb3/Rpb11 dimerisation domain |