Result : C0H3S3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YwzD |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3733505 |
| Right | 3733648 |
| Strand | - |
| Nucleotide Sequence | ATGAGTGAAAAGAAATTGAATCAAGAAGAATTTCTGAAAATTTTGATGCATGCACATGAAATTGGTGAGCAGTCATCTGAGATGACGACGAAGGAAATGCTTGAAAATTTGATTTCTCATATTAAAAATGGATATGCAACATAA |
| Sequence | MSEKKLNQEEFLKILMHAHEIGEQSSEMTTKEMLENLISHIKNGYAT |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H3S3 |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2507719 | 2507862 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 2 | 3526748 | 3526891 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 3 | 3733505 | 3733648 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 4 | 3555753 | 3555896 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 3601228 | 3601371 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 6 | 3545054 | 3545197 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 7 | 3601871 | 3602014 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 8 | 449463 | 449606 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 3596626 | 3596769 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 4114362 | 4114505 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 3883851 | 3883994 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 3683379 | 3683522 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 13 | 2009340 | 2009483 | + | NZ_CP043404.1 | Bacillus safensis |
| 14 | 3288851 | 3288994 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 2066453 | 2066596 | + | NZ_CP017786.1 | Bacillus xiamenensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP029364.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00455.24 | 0.67 | 10 | 5559.0 | same-strand | DeoR C terminal sensor domain |
| 2 | PF08220.14 | 0.67 | 10 | 5559.0 | same-strand | DeoR-like helix-turn-helix domain |
| 3 | PF08279.14 | 0.93 | 14 | 5555 | same-strand | HTH domain |
| 4 | PF08282.14 | 0.87 | 13 | 4698 | same-strand | haloacid dehalogenase-like hydrolase |
| 5 | PF00176.25 | 1.0 | 15 | 1801 | opposite-strand | SNF2-related domain |
| 6 | PF12419.10 | 1.0 | 15 | 1801 | opposite-strand | SNF2 Helicase protein |
| 7 | PF00271.33 | 1.0 | 15 | 1801 | opposite-strand | Helicase conserved C-terminal domain |
| 8 | PF04851.17 | 1.0 | 15 | 1801 | opposite-strand | Type III restriction enzyme, res subunit |
| 9 | PF04434.19 | 0.67 | 10 | 204.0 | opposite-strand | SWIM zinc finger |
| 10 | PF02706.17 | 0.8 | 12 | 226.0 | same-strand | Chain length determinant protein |
| 11 | PF19567.1 | 0.8 | 12 | 1725.0 | same-strand | Capsular polysaccharide synthesis, CpsB/CapC |
| 12 | PF03721.16 | 0.87 | 13 | 2671 | same-strand | UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain |
| 13 | PF00984.21 | 0.87 | 13 | 2671 | same-strand | UDP-glucose/GDP-mannose dehydrogenase family, central domain |
| 14 | PF03720.17 | 0.87 | 13 | 2671 | same-strand | UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain |
++ More..