Result : EXP03584
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03584 |
| NCBI Accession ID | |
| Organism | Escherichia |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGACAACTTCAAGCGTATAGTAGGTGAACAGGCGAAAAAGAGGATCGAAGCGTCTCACATTTTAGGGGACCAAATCGTGATCAACAAAATGTGA |
| Sequence | MDNFKRIVGEQAKKRIEASHILGDQIVINKM |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 31 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3583005 | 3583100 | - | NZ_AP014857.1 | Escherichia albertii |
| 2 | 4353783 | 4353878 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 227502 | 227597 | + | NZ_CP061527.1 | Shigella dysenteriae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP014857.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00528.24 | 1.0 | 3 | 2453.0 | opposite-strand | Binding-protein-dependent transport system inner membrane component |
| 2 | PF19300.1 | 1.0 | 3 | 2868 | opposite-strand | Binding-prot-dependent transport system membrane comp, N-term |
| 3 | PF00005.29 | 1.0 | 3 | 872.5 | opposite-strand | ABC transporter |
| 4 | PF13401.8 | 1.0 | 3 | 471 | opposite-strand | AAA domain |
| 5 | PF02463.21 | 1.0 | 3 | 471 | opposite-strand | RecF/RecN/SMC N terminal domain |
| 6 | PF08753.13 | 1.0 | 3 | 64 | opposite-strand | NikR C terminal nickel binding domain |
| 7 | PF01402.23 | 1.0 | 3 | 64 | opposite-strand | Ribbon-helix-helix protein, copG family |
| 8 | PF07702.15 | 1.0 | 3 | 40 | opposite-strand | UTRA domain |
| 9 | PF00392.23 | 1.0 | 3 | 40 | opposite-strand | Bacterial regulatory proteins, gntR family |
| 10 | PF00359.24 | 0.67 | 2 | 810.5 | opposite-strand | Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 |
| 11 | PF02302.19 | 0.67 | 2 | 1280.5 | opposite-strand | PTS system, Lactose/Cellobiose specific IIB subunit |
| 12 | PF03611.16 | 0.67 | 2 | 1638.5 | opposite-strand | PTS system sugar-specific permease component |
| 13 | PF00370.23 | 0.67 | 2 | 2989.5 | opposite-strand | FGGY family of carbohydrate kinases, N-terminal domain |
| 14 | PF02782.18 | 0.67 | 2 | 2989.5 | opposite-strand | FGGY family of carbohydrate kinases, C-terminal domain |
++ More..