Result : C0H3R7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized lipoprotein YvzJ |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3568282 |
| Right | 3568491 |
| Strand | + |
| Nucleotide Sequence | ATGAAGAAAATCATGCTGTTTCTGGCAATGACGTCAATTCTTTCAGCATGTCAGCCCAACTATACCGGGAAATACATAGAAATTGGGGATACACTAACTGACTATACCAAAGAGTGCTTTAAAGAGAATGAAATTCCTTATAAATACGAAAAGGGAAAACTGTATATCCCAGAAGACGCATTTGATACAGCAATCTACACTTGTTCATAA |
| Sequence | MKKIMLFLAMTSILSACQPNYTGKYIEIGDTLTDYTKECFKENEIPYKYEKGKLYIPEDAFDTAIYTCS |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H3R7 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3568282 | 3568491 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3432734 | 3432943 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 3370759 | 3370968 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 3419896 | 3420105 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 3351124 | 3351333 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 2684784 | 2684993 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 3388794 | 3389003 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 353622 | 353831 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02826.21 | 0.88 | 7 | 4740 | same-strand | D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain |
| 2 | PF00389.32 | 0.88 | 7 | 4740 | same-strand | D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain |
| 3 | PF02687.23 | 0.88 | 7 | 2761 | opposite-strand | FtsX-like permease family |
| 4 | PF00005.29 | 1.0 | 8 | 2007.0 | opposite-strand | ABC transporter |
| 5 | PF02518.28 | 0.88 | 7 | 854 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 6 | PF00512.27 | 0.88 | 7 | 854 | opposite-strand | His Kinase A (phospho-acceptor) domain |
| 7 | PF00486.30 | 0.88 | 7 | 147 | opposite-strand | Transcriptional regulatory protein, C terminal |
| 8 | PF00072.26 | 0.88 | 7 | 147 | opposite-strand | Response regulator receiver domain |
| 9 | PF00797.19 | 0.88 | 7 | 36 | opposite-strand | N-acetyltransferase |
| 10 | PF00381.21 | 0.88 | 7 | 801 | opposite-strand | PTS HPr component phosphorylation site |
| 11 | PF14527.8 | 0.88 | 7 | 1082 | opposite-strand | WhiA LAGLIDADG-like domain |
| 12 | PF10298.11 | 0.88 | 7 | 1082 | opposite-strand | WhiA N-terminal LAGLIDADG-like domain |
| 13 | PF02650.16 | 0.88 | 7 | 1082 | opposite-strand | WhiA C-terminal HTH domain |
| 14 | PF01933.20 | 0.88 | 7 | 2055 | opposite-strand | 2-phospho-L-lactate transferase CofD |
| 15 | PF03668.17 | 0.88 | 7 | 3010 | opposite-strand | P-loop ATPase protein family |
++ More..