Result : EXP03576
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03576 |
| NCBI Accession ID | |
| Organism | Oscillibacter,Faecalibacterium |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAACAAACGTACCCGCGCCGTGGCGCTGATTTTGGTGGTGGTCATGGTCATTGCGCTGCTGGCGTCCATGGTGGCCCCCTACCTGCTGTACTGA |
| Sequence | MNKRTRAVALILVVVMVIALLASMVAPYLLY |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 31 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2499464 | 2499556 | - | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 2 | 20296 | 20394 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_016048.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06107.13 | 1.0 | 2 | -3.0 | same-strand | Bacterial protein of unknown function (DUF951) |
| 2 | PF00575.25 | 1.0 | 2 | 285.0 | opposite-strand | S1 RNA binding domain |
| 3 | PF12002.10 | 1.0 | 2 | 1201.0 | same-strand | MgsA AAA+ ATPase C terminal |
| 4 | PF16193.7 | 1.0 | 2 | 1201.0 | same-strand | AAA C-terminal domain |
| 5 | PF00004.31 | 1.0 | 2 | 1201.0 | same-strand | ATPase family associated with various cellular activities (AAA) |
++ More..