| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sigma-O factor regulatory protein RsoA |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3409219 |
| Right | 3409458 |
| Strand | - |
| Nucleotide Sequence | GTGGACGGCCAGTTTGAACAAAAAAAGAAACAAAAAGACGAGACTTATGACATTGAGCACCTGATTGCATGCTTTTCACCGATGATCAGAAAAAAACTCAGCAATACGTCCTATCAAGAAAGAGAAGATTTAGAGCAAGAGCTGAAGATCAAAATGTTTGAAAAGGCTGATATGCTTTTATGTCAGGATGTACCGGGGTTTTGGGAGTTTATTTTGTACATGGTAGATGAGAACTCATAA |
| Sequence | MDGQFEQKKKQKDETYDIEHLIACFSPMIRKKLSNTSYQEREDLEQELKIKMFEKADMLLCQDVPGFWEFILYMVDENS |
| Source of smORF | Swiss-Prot |
| Function | Together with RNA polymerase sigma factor SigO, positively regulates the expression of at least three operons, including oxdC-yvrL, sigO-rsoA and yvrJ. Required for the acid stress-dependent induction of the oxalate decarboxylase oxdC. {ECO:0000269|Pubmed:18573182, ECO:0000269|Pubmed:19047353}. |
| Pubmed ID | 9384377 18573182 19047353 |
| Domain | CDD:184493 |
| Functional Category | Others |
| Uniprot ID | C0H3R4 |
| ORF Length (Amino Acid) | 79 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3409219 | 3409458 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3276520 | 3276756 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 3268945 | 3269181 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 2847758 | 2847994 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 3193994 | 3194230 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 3217415 | 3217651 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 7 | 3222193 | 3222429 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 775813 | 776049 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 3240739 | 3240975 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01497.20 | 1.0 | 9 | 4782 | same-strand | Periplasmic binding protein |
| 2 | PF00106.27 | 1.0 | 9 | 3593 | opposite-strand | short chain dehydrogenase |
| 3 | PF13561.8 | 1.0 | 9 | 3593 | opposite-strand | Enoyl-(Acyl carrier protein) reductase |
| 4 | PF08450.14 | 1.0 | 9 | 2677 | same-strand | SMP-30/Gluconolactonase/LRE-like region |
| 5 | PF02518.28 | 1.0 | 9 | 864 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 6 | PF00512.27 | 1.0 | 9 | 864 | same-strand | His Kinase A (phospho-acceptor) domain |
| 7 | PF00072.26 | 1.0 | 9 | 153 | same-strand | Response regulator receiver domain |
| 8 | PF00486.30 | 1.0 | 9 | 153 | same-strand | Transcriptional regulatory protein, C terminal |
| 9 | PF04545.18 | 1.0 | 9 | -3 | same-strand | Sigma-70, region 4 |
| 10 | PF08281.14 | 1.0 | 9 | -3 | same-strand | Sigma-70, region 4 |
| 11 | PF12841.9 | 1.0 | 9 | 737 | opposite-strand | YvrJ protein family |
| 12 | PF00190.24 | 1.0 | 9 | 1014 | opposite-strand | Cupin |
| 13 | PF07883.13 | 1.0 | 9 | 1014 | opposite-strand | Cupin domain |
| 14 | PF14184.8 | 1.0 | 9 | 2235 | opposite-strand | Regulatory protein YrvL |
| 15 | PF12704.9 | 0.78 | 7 | 2671 | same-strand | MacB-like periplasmic core domain |
| 16 | PF02687.23 | 0.78 | 7 | 2671 | same-strand | FtsX-like permease family |