| Protein name |
EXP03572 |
| NCBI Accession ID |
|
| Organism |
Ruminococcus,Sandaracinus |
| Left |
|
| Right |
|
| Strand |
|
| Nucleotide Sequence |
ATGAAAATTGTAGTGGTGAAAACACCCAAACTGTTAACCGGAATTTTTCGGTTGGTTTTTAAAGTGAAACGGGCAGAACCAGAGTCCGACAGCTGA |
| Sequence |
MKIVVVKTPKLLTGIFRLVFKVKRAEPESDS |
| Source of smORF |
Metagenomic Ribo-seq |
| Function |
The ORF matches to the profile of cl26797. Profile Description: Stage V sporulation protein family. Members of this family are SpoVM (stage V sporulation protein M). |
| Pubmed ID |
32601270
|
| Domain |
CDD:391612 |
| Functional Category |
Conserved domain based functional assignment |
| Uniprot ID |
|
| ORF Length (Amino Acid) |
31 |