Protein name |
EXP03572 |
NCBI Accession ID |
|
Organism |
Ruminococcus,Sandaracinus |
Left |
|
Right |
|
Strand |
|
Nucleotide Sequence |
ATGAAAATTGTAGTGGTGAAAACACCCAAACTGTTAACCGGAATTTTTCGGTTGGTTTTTAAAGTGAAACGGGCAGAACCAGAGTCCGACAGCTGA |
Sequence |
MKIVVVKTPKLLTGIFRLVFKVKRAEPESDS |
Source of smORF |
Metagenomic Ribo-seq |
Function |
The ORF matches to the profile of cl26797. Profile Description: Stage V sporulation protein family. Members of this family are SpoVM (stage V sporulation protein M). |
Pubmed ID |
32601270
|
Domain |
CDD:391612 |
Functional Category |
Conserved domain based functional assignment |
Uniprot ID |
|
ORF Length (Amino Acid) |
31 |