Result : EXP03565
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03565 |
| NCBI Accession ID | |
| Organism | Lachnoclostridium,Intestinimonas |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAATACGAATTTTCATTTAACCGATCAGCGCAAAAAGAAAATCAACTCTGTACAATCCATTCCGATGAAACATTGTGCAGAGTATAGCGTATAA |
| Sequence | MNTNFHLTDQRKKKINSVQSIPMKHCAEYSV |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 31 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2231694 | 2231789 | + | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 2 | 837064 | 837153 | - | NZ_CP048649.1 | Aminipila butyrica |
| 3 | 318781 | 318870 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 4 | 4165991 | 4166095 | + | NZ_CP022464.2 | Enterocloster bolteae |
| 5 | 303067 | 303168 | - | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 6 | 849993 | 850082 | + | NZ_AP019845.1 | Leptotrichia trevisanii |
| 7 | 2869519 | 2869611 | - | NZ_CP039126.1 | Blautia producta |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT635479.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.71 | 5 | 282.5 | same-strand | ABC transporter |
| 2 | PF12848.9 | 0.71 | 5 | 228 | same-strand | ABC transporter |
++ More..