Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YvzF |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 3390479 |
Right | 3390664 |
Strand | - |
Nucleotide Sequence | GTGGCACAGGTAAGGCTAGCTGGAAAACAAGAAGAAATTGAACAGCTCATTAGATCATTTGAACAGCATTATGATGTCTCTTATACATCAAAGGAGTACGGCAGGACAAATCCAAAATACAAATATTCAAAGGATTCCCGCGTATATCTTGAATTAAAATTAAAATCTGCCAAGATCGAAAAATAA |
Sequence | MAQVRLAGKQEEIEQLIRSFEQHYDVSYTSKEYGRTNPKYKYSKDSRVYLELKLKSAKIEK |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam13113. Profile Description: Protein of unknown function (DUF3970). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 60 amino acids in length. There is a conserved NPKY sequence motif. |
Pubmed ID | 9384377 |
Domain | CDD:372483 |
Functional Category | Others |
Uniprot ID | C0H3R3 |
ORF Length (Amino Acid) | 61 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3390479 | 3390664 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 3257785 | 3257970 | - | NZ_CP013984.1 | Bacillus inaquosorum |
3 | 3203469 | 3203654 | - | NZ_CP048852.1 | Bacillus tequilensis |
4 | 3198663 | 3198848 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
5 | 3175231 | 3175416 | - | NZ_CP051464.1 | Bacillus mojavensis |
6 | 2866566 | 2866751 | + | NZ_CP029364.1 | Bacillus halotolerans |
7 | 3250209 | 3250394 | - | NZ_CP033052.1 | Bacillus vallismortis |
8 | 794276 | 794461 | + | NZ_CP011937.1 | Bacillus velezensis |
9 | 3222329 | 3222514 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
10 | 3742571 | 3742738 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
11 | 3552890 | 3553057 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
12 | 2982412 | 2982579 | - | NZ_CP011150.1 | Bacillus altitudinis |
13 | 2326526 | 2326693 | + | NZ_CP043404.1 | Bacillus safensis |
14 | 3328427 | 3328594 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
15 | 2426357 | 2426524 | + | NZ_CP017786.1 | Bacillus xiamenensis |
16 | 943098 | 943271 | - | NZ_CP024035.1 | Priestia aryabhattai |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00072.26 | 0.94 | 15 | 4084 | same-strand | Response regulator receiver domain |
2 | PF00486.30 | 0.88 | 14 | 4087.0 | opposite-strand | Transcriptional regulatory protein, C terminal |
3 | PF02518.28 | 0.94 | 15 | 2815.0 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
4 | PF00672.27 | 0.94 | 15 | 2815.0 | opposite-strand | HAMP domain |
5 | PF00512.27 | 0.94 | 15 | 2738 | opposite-strand | His Kinase A (phospho-acceptor) domain |
6 | PF14501.8 | 0.94 | 15 | 2738 | opposite-strand | GHKL domain |
7 | PF00440.25 | 0.94 | 15 | 1495 | opposite-strand | Bacterial regulatory proteins, tetR family |
8 | PF00206.22 | 0.94 | 15 | 68 | same-strand | Lyase |
9 | PF10415.11 | 0.94 | 15 | 68 | same-strand | Fumarase C C-terminus |
10 | PF03323.15 | 0.94 | 15 | 118 | opposite-strand | Bacillus/Clostridium GerA spore germination protein |
11 | PF03845.15 | 0.94 | 15 | 1535 | opposite-strand | Spore germination protein |
12 | PF05504.13 | 0.94 | 15 | 2629 | opposite-strand | Spore germination B3/ GerAC like, C-terminal |
13 | PF00196.21 | 0.94 | 15 | 3786 | same-strand | Bacterial regulatory proteins, luxR family |
14 | PF08281.14 | 0.94 | 15 | 3786 | same-strand | Sigma-70, region 4 |
15 | PF04545.18 | 0.69 | 11 | 3758 | same-strand | Sigma-70, region 4 |