Result : EXP03562
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03562 |
| NCBI Accession ID | |
| Organism | Peptostreptococcus |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGCCTTTTGAACTTCGCCTTCCGGCTAAAAAGCCTTTAGCTCTAGGTAATATGTCCAAAGAAGATCTAAACTTAGAACTTCAAAAAGGAATTGACTCTTTAAATGACGGAAAATCTTATAGTGCAGATGAAGTTGATGAGTCTATGTAA |
| Sequence | MPFELRLPAKKPLALGNMSKEDLNLELQKGIDSLNDGKSYSADEVDESM |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2591719 | 2591886 | + | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 2 | 2806638 | 2806805 | - | NZ_AP019309.1 | Intestinibaculum porci |
| 3 | 1881156 | 1881323 | - | NZ_AP019309.1 | Intestinibaculum porci |
| 4 | 2006143 | 2006310 | + | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 5 | 1742782 | 1742949 | + | NC_013895.2 | Mageeibacillus indolicus UPII9-5 |
| 6 | 1586881 | 1587048 | + | NZ_LR699011.1 | Roseburia hominis |
| 7 | 879838 | 880008 | - | NZ_LT990039.1 | Massilistercora timonensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP036170.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05016.17 | 0.67 | 4 | -3 | same-strand | ParE toxin of type II toxin-antitoxin system, parDE |
++ More..