Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YuzM |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 3373743 |
Right | 3373988 |
Strand | + |
Nucleotide Sequence | ATGGATAATCAGCAGCAATCTCAAATGCCGCCTTCCGTTATTTCGACAAAGGATCATTTGTATCTCAATGACATGCTGAACTGGAATTTGCTCGCGATGAAAAAAGCGCATTTCATGGCGCAGCAGTGCCAGGATCAAACGTTAAAGCAAGAACTCGACCGCGTCGGACACATGCATCATGATCACTATCAAAGAATATTAAAGCACCTGCAGCCAGGCCAGCAGCAGTCCGGCTACATCCAATAA |
Sequence | MDNQQQSQMPPSVISTKDHLYLNDMLNWNLLAMKKAHFMAQQCQDQTLKQELDRVGHMHHDHYQRILKHLQPGQQQSGYIQ |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | C0H3R1 |
ORF Length (Amino Acid) | 81 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3373743 | 3373988 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 3241045 | 3241290 | + | NZ_CP013984.1 | Bacillus inaquosorum |
3 | 3181867 | 3182112 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
4 | 3158479 | 3158724 | + | NZ_CP051464.1 | Bacillus mojavensis |
5 | 2883242 | 2883487 | - | NZ_CP029364.1 | Bacillus halotolerans |
6 | 3185448 | 3185693 | + | NZ_CP048852.1 | Bacillus tequilensis |
7 | 3233466 | 3233711 | + | NZ_CP033052.1 | Bacillus vallismortis |
8 | 3723706 | 3723960 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
9 | 814198 | 814455 | - | NZ_CP011937.1 | Bacillus velezensis |
10 | 3204849 | 3205106 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
11 | 2336969 | 2337175 | - | NZ_CP043404.1 | Bacillus safensis |
12 | 3535391 | 3535642 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
13 | 3311212 | 3311445 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
14 | 2972095 | 2972310 | + | NZ_CP011150.1 | Bacillus altitudinis |
15 | 2436689 | 2436895 | - | NZ_CP017786.1 | Bacillus xiamenensis |
16 | 3278931 | 3279143 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
17 | 2440692 | 2440931 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
18 | 591655 | 591879 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
19 | 77434 | 77685 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
20 | 3287316 | 3287543 | + | NZ_LS483476.1 | Lederbergia lentus |
21 | 964608 | 964817 | - | NZ_CP070511.1 | Parageobacillus toebii |
22 | 1844922 | 1845164 | - | NZ_CP017703.1 | Aeribacillus pallidus |
23 | 3096946 | 3097182 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
24 | 2662011 | 2662262 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
25 | 3333801 | 3334019 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
26 | 2725903 | 2726103 | + | NZ_CP012024.1 | Bacillus smithii |
27 | 2835783 | 2835989 | - | NZ_CP022983.1 | Cytobacillus kochii |
28 | 3599417 | 3599614 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
29 | 1223661 | 1223903 | - | NZ_CP065425.1 | Heyndrickxia vini |
30 | 4035164 | 4035376 | + | NZ_CP053989.1 | Niallia circulans |
31 | 817896 | 818096 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
32 | 2226352 | 2226552 | + | NZ_CP061470.1 | Geobacillus zalihae |
33 | 1518159 | 1518374 | - | NZ_CP020772.1 | Halobacillus mangrovi |
34 | 1138323 | 1138568 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00441.26 | 0.97 | 33 | 4919 | opposite-strand | Acyl-CoA dehydrogenase, C-terminal domain |
2 | PF02771.18 | 0.97 | 33 | 4919 | opposite-strand | Acyl-CoA dehydrogenase, N-terminal domain |
3 | PF02770.21 | 0.97 | 33 | 4919 | opposite-strand | Acyl-CoA dehydrogenase, middle domain |
4 | PF08028.13 | 0.97 | 33 | 4919 | opposite-strand | Acyl-CoA dehydrogenase, C-terminal domain |
5 | PF00108.25 | 0.94 | 32 | 3729.0 | opposite-strand | Thiolase, N-terminal domain |
6 | PF02803.20 | 0.94 | 32 | 3729.0 | opposite-strand | Thiolase, C-terminal domain |
7 | PF02737.20 | 0.97 | 33 | 1349 | opposite-strand | 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain |
8 | PF00725.24 | 0.97 | 33 | 1349 | opposite-strand | 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain |
9 | PF14115.8 | 0.68 | 23 | 1029 | same-strand | YuzL-like protein |
10 | PF07875.14 | 1.0 | 34 | 13.5 | same-strand | Coat F domain |