Result : C0H3R0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YuzL |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3372569 |
| Right | 3372715 |
| Strand | + |
| Nucleotide Sequence | ATGGTACGAGAGAAAAAAAATCCGTCTTCAGCGGCAGTCAGCGCGGCGAGCGTAAAGGGAGATGCCGGTCCGACTCAGCATTACGGCGGCGGAAAACGGACAAGTCAAAATCAGCAGTATAAAAAACATAACATGGGACAATCATAA |
| Sequence | MVREKKNPSSAAVSAASVKGDAGPTQHYGGGKRTSQNQQYKKHNMGQS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam14115. Profile Description: YuzL-like protein. The YuzL-like protein family includes the B. subtilis YuzL protein, which is functionally uncharacterized. This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 50 amino acids in length. |
| Pubmed ID | 9384377 |
| Domain | CDD:316626 |
| Functional Category | Others |
| Uniprot ID | C0H3R0 |
| ORF Length (Amino Acid) | 48 |
++ More..
| Conservation Analysis |
No. of Species: 43
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3372569 | 3372715 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3239870 | 3240016 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2884523 | 2884666 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 4 | 3157300 | 3157443 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 5 | 3180693 | 3180839 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 6 | 3232292 | 3232438 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 3184273 | 3184419 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 614897 | 615052 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 9 | 819464 | 819613 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 10 | 262908 | 263057 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 11 | 3033783 | 3033932 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 12 | 2224836 | 2224985 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 13 | 76034 | 76183 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 14 | 966134 | 966283 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 15 | 2884486 | 2884641 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 16 | 2660670 | 2660819 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 17 | 593035 | 593184 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 18 | 815483 | 815623 | - | NZ_CP011937.1 | Bacillus velezensis |
| 19 | 3201366 | 3201506 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 20 | 2439433 | 2439579 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 21 | 2337247 | 2337384 | - | NZ_CP043404.1 | Bacillus safensis |
| 22 | 2436968 | 2437105 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 23 | 2694557 | 2694688 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 24 | 3891886 | 3892014 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 25 | 2971911 | 2972048 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 26 | 1223968 | 1224099 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 27 | 4745868 | 4746017 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 28 | 4034948 | 4035082 | + | NZ_CP053989.1 | Niallia circulans |
| 29 | 3310960 | 3311121 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 30 | 3535153 | 3535314 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 31 | 3723516 | 3723677 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 32 | 4785439 | 4785585 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 33 | 391495 | 391641 | - | NZ_CP040336.1 | Bacillus luti |
| 34 | 4954430 | 4954576 | + | NC_011725.1 | Bacillus cereus B4264 |
| 35 | 4989102 | 4989248 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 36 | 4757941 | 4758087 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 37 | 1260757 | 1260888 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 38 | 3739070 | 3739213 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 39 | 4055869 | 4056003 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 40 | 3652566 | 3652712 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 41 | 3335212 | 3335337 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 42 | 2997586 | 2997717 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 43 | 1997397 | 1997528 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01597.21 | 0.84 | 36 | 6140.0 | opposite-strand | Glycine cleavage H-protein |
| 2 | PF03960.17 | 0.84 | 36 | 5707.0 | opposite-strand | ArsC family |
| 3 | PF00441.26 | 1.0 | 43 | 3849 | opposite-strand | Acyl-CoA dehydrogenase, C-terminal domain |
| 4 | PF02771.18 | 1.0 | 43 | 3849 | opposite-strand | Acyl-CoA dehydrogenase, N-terminal domain |
| 5 | PF02770.21 | 1.0 | 43 | 3849 | opposite-strand | Acyl-CoA dehydrogenase, middle domain |
| 6 | PF08028.13 | 1.0 | 43 | 3849 | opposite-strand | Acyl-CoA dehydrogenase, C-terminal domain |
| 7 | PF00108.25 | 0.98 | 42 | 2607.5 | opposite-strand | Thiolase, N-terminal domain |
| 8 | PF02803.20 | 0.98 | 42 | 2607.5 | opposite-strand | Thiolase, C-terminal domain |
| 9 | PF02737.20 | 1.0 | 43 | 191 | opposite-strand | 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain |
| 10 | PF00725.24 | 1.0 | 43 | 191 | opposite-strand | 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain |
| 11 | PF01619.20 | 0.74 | 32 | 84.0 | opposite-strand | Proline dehydrogenase |
| 12 | PF07875.14 | 0.74 | 32 | 1295.5 | same-strand | Coat F domain |
++ More..