Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YuzK |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 3360974 |
Right | 3361111 |
Strand | - |
Nucleotide Sequence | ATGGAAAAAGCGATGCAGCTGTCACACGGAATTGGATACGAGGAATATGGACGCCGGCTGGAAACAAGAATGAAAGTAGAGCGGCAGAGAGAGCTTGATTATGAAAAAAGCAAGCGGATTTCTGCGGGAGCTTATTGA |
Sequence | MEKAMQLSHGIGYEEYGRRLETRMKVERQRELDYEKSKRISAGAY |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | C0H3Q9 |
ORF Length (Amino Acid) | 45 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3360974 | 3361111 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 3228277 | 3228414 | - | NZ_CP013984.1 | Bacillus inaquosorum |
3 | 3172496 | 3172633 | - | NZ_CP048852.1 | Bacillus tequilensis |
4 | 3169099 | 3169236 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
5 | 3220704 | 3220841 | - | NZ_CP033052.1 | Bacillus vallismortis |
6 | 2896122 | 2896274 | + | NZ_CP029364.1 | Bacillus halotolerans |
7 | 3145689 | 3145841 | - | NZ_CP051464.1 | Bacillus mojavensis |
8 | 3189754 | 3189906 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
9 | 827084 | 827236 | + | NZ_CP011937.1 | Bacillus velezensis |
10 | 2844951 | 2845097 | + | NZ_CP024035.1 | Priestia aryabhattai |
11 | 3673110 | 3673262 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
12 | 1581752 | 1581904 | + | NZ_CP022437.1 | Virgibacillus necropolis |
13 | 2453524 | 2453676 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
14 | 2849494 | 2849646 | + | NZ_CP022983.1 | Cytobacillus kochii |
15 | 3876686 | 3876838 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
16 | 3711801 | 3711947 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
17 | 3723823 | 3723975 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
18 | 48503 | 48649 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
19 | 4040584 | 4040736 | - | NZ_CP042593.1 | Bacillus dafuensis |
20 | 3299245 | 3299391 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
21 | 3254890 | 3255042 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
22 | 629186 | 629338 | + | NZ_CP016020.1 | Bacillus weihaiensis |
23 | 3523432 | 3523578 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
24 | 3265864 | 3266013 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
25 | 32714 | 32866 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
26 | 2508052 | 2508204 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
27 | 751676 | 751828 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
28 | 2349142 | 2349288 | + | NZ_CP043404.1 | Bacillus safensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01458.19 | 0.93 | 26 | 2098 | same-strand | SUF system FeS cluster assembly, SufBD |
2 | PF01592.18 | 0.93 | 26 | 3607.0 | same-strand | NifU-like N terminal domain |
3 | PF00266.21 | 0.93 | 26 | 2397.0 | same-strand | Aminotransferase class-V |
4 | PF00005.29 | 1.0 | 28 | 1714.0 | same-strand | ABC transporter |
5 | PF02463.21 | 0.96 | 27 | 390 | same-strand | RecF/RecN/SMC N terminal domain |
6 | PF02627.22 | 0.68 | 19 | 193 | same-strand | Carboxymuconolactone decarboxylase family |
7 | PF03180.16 | 0.96 | 27 | 656 | same-strand | NlpA lipoprotein |
8 | PF00528.24 | 0.96 | 27 | 1493 | same-strand | Binding-protein-dependent transport system inner membrane component |
9 | PF09383.12 | 0.96 | 27 | 2154 | same-strand | NIL domain |