Result : C0H3Q9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YuzK |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3360974 |
| Right | 3361111 |
| Strand | - |
| Nucleotide Sequence | ATGGAAAAAGCGATGCAGCTGTCACACGGAATTGGATACGAGGAATATGGACGCCGGCTGGAAACAAGAATGAAAGTAGAGCGGCAGAGAGAGCTTGATTATGAAAAAAGCAAGCGGATTTCTGCGGGAGCTTATTGA |
| Sequence | MEKAMQLSHGIGYEEYGRRLETRMKVERQRELDYEKSKRISAGAY |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H3Q9 |
| ORF Length (Amino Acid) | 45 |
++ More..
| Conservation Analysis |
No. of Species: 28
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3360974 | 3361111 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3228277 | 3228414 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 3172496 | 3172633 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 3169099 | 3169236 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 3220704 | 3220841 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 2896122 | 2896274 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 3145689 | 3145841 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 3189754 | 3189906 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 827084 | 827236 | + | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 2844951 | 2845097 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 11 | 3673110 | 3673262 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 12 | 1581752 | 1581904 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 13 | 2453524 | 2453676 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 14 | 2849494 | 2849646 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 15 | 3876686 | 3876838 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 16 | 3711801 | 3711947 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 17 | 3723823 | 3723975 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 18 | 48503 | 48649 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 19 | 4040584 | 4040736 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 20 | 3299245 | 3299391 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 21 | 3254890 | 3255042 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 22 | 629186 | 629338 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 23 | 3523432 | 3523578 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 24 | 3265864 | 3266013 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 25 | 32714 | 32866 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 26 | 2508052 | 2508204 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 27 | 751676 | 751828 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
| 28 | 2349142 | 2349288 | + | NZ_CP043404.1 | Bacillus safensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01458.19 | 0.93 | 26 | 2098 | same-strand | SUF system FeS cluster assembly, SufBD |
| 2 | PF01592.18 | 0.93 | 26 | 3607.0 | same-strand | NifU-like N terminal domain |
| 3 | PF00266.21 | 0.93 | 26 | 2397.0 | same-strand | Aminotransferase class-V |
| 4 | PF00005.29 | 1.0 | 28 | 1714.0 | same-strand | ABC transporter |
| 5 | PF02463.21 | 0.96 | 27 | 390 | same-strand | RecF/RecN/SMC N terminal domain |
| 6 | PF02627.22 | 0.68 | 19 | 193 | same-strand | Carboxymuconolactone decarboxylase family |
| 7 | PF03180.16 | 0.96 | 27 | 656 | same-strand | NlpA lipoprotein |
| 8 | PF00528.24 | 0.96 | 27 | 1493 | same-strand | Binding-protein-dependent transport system inner membrane component |
| 9 | PF09383.12 | 0.96 | 27 | 2154 | same-strand | NIL domain |
++ More..