Result : EXP03530
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03530 |
| NCBI Accession ID | |
| Organism | Desulfobulbus,Cardiobacterium,Lautropia,Kingella |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGCAAACCTTTACCTTGAACAACGGCGTACAAATCCCCGTCCTCGGCTTCGGCGTCTTCCAGATTCCGCCCGCAGAAACCGCGCAGGCAGTGGCGTAG |
| Sequence | MQTFTLNNGVQIPVLGFGVFQIPPAETAQAVA |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 32 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3457955 | 3458068 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 2 | 1310705 | 1310809 | - | NZ_CP046293.1 | Yersinia intermedia |
| 3 | 148399 | 148512 | + | NZ_CP031513.1 | Bombilactobacillus bombi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009428.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00664.25 | 0.67 | 2 | 4619 | opposite-strand | ABC transporter transmembrane region |
| 2 | PF00005.29 | 0.67 | 2 | 4619 | opposite-strand | ABC transporter |
| 3 | PF00248.23 | 0.67 | 2 | 37 | same-strand | Aldo/keto reductase family |
++ More..