Result : C0H3Q8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized HTH-type transcriptional regulator YuzN |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3355045 |
| Right | 3355323 |
| Strand | - |
| Nucleotide Sequence | ATGAATGGGAACAAAGACGCTATATTCAAAGCACTCGGCGATTCGACTCGGCGGCTTATATTAGACGAATTATCTGAACGCAACGAGCTGACGTTGTATGAACTTACGATACGTCTTATTACAAAGTACGACCTTTCTATTACGCGACAGGCGATAGCTAAACACCTTTCTGTACTGGAGGATGCAGGACTCGTAACATCAAAACGAAAGGGAAAATATCGAGTACTTATATTCAACAACGAACCGCTTAAAAATTTGCTGAAAGGATGGATAGAATAA |
| Sequence | MNGNKDAIFKALGDSTRRLILDELSERNELTLYELTIRLITKYDLSITRQAIAKHLSVLEDAGLVTSKRKGKYRVLIFNNEPLKNLLKGWIE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl21459. Profile Description: Helix-turn-helix domains. This winged helix-turn-helix domain contains an extended C-terminal alpha helix which is responsible for dimerization of this domain. |
| Pubmed ID | 9384377 |
| Domain | CDD:419669 |
| Functional Category | DNA-binding |
| Uniprot ID | C0H3Q8 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 45
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3355045 | 3355323 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3222158 | 3222436 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 4234527 | 4234805 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 4 | 3390150 | 3390428 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 5 | 4555122 | 4555400 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 6 | 3163017 | 3163295 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 7 | 3266683 | 3266961 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 8 | 2585634 | 2585912 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 9 | 1742672 | 1742947 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 10 | 553478 | 553756 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 11 | 1991554 | 1991832 | + | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 12 | 3082925 | 3083203 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 13 | 3227604 | 3227882 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 14 | 3104166 | 3104414 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 15 | 1697535 | 1697795 | + | NZ_CP031142.1 | Saccharopolyspora pogona |
| 16 | 2982753 | 2983046 | + | NZ_CP023445.1 | Actinosynnema pretiosum |
| 17 | 679373 | 679642 | + | NZ_CP053564.1 | Pseudonocardia broussonetiae |
| 18 | 5839886 | 5840170 | + | NZ_CP035758.1 | Ktedonosporobacter rubrisoli |
| 19 | 3749238 | 3749468 | + | NZ_CP026652.1 | Streptomyces dengpaensis |
| 20 | 2950644 | 2950937 | + | NC_013093.1 | Actinosynnema mirum DSM 43827 |
| 21 | 511055 | 511348 | + | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
| 22 | 4532749 | 4533060 | - | NZ_AP022586.1 | Mycolicibacterium litorale |
| 23 | 3156052 | 3156348 | + | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 24 | 5090676 | 5090972 | + | NZ_LR134355.1 | Mycolicibacterium chitae |
| 25 | 7599267 | 7599560 | - | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 26 | 825994 | 826224 | + | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 27 | 5140348 | 5140641 | - | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 28 | 3425533 | 3425796 | - | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 29 | 1380691 | 1380921 | - | NZ_CP023202.1 | Streptomyces xinghaiensis S187 |
| 30 | 3743188 | 3743448 | + | NZ_CP022088.2 | Nocardia brasiliensis |
| 31 | 4476700 | 4476993 | + | NZ_CP054938.1 | Streptomyces harbinensis |
| 32 | 5073823 | 5074062 | - | NZ_AP022617.1 | Mycolicibacterium monacense |
| 33 | 616613 | 616909 | - | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 34 | 317019 | 317312 | - | NZ_CP031742.1 | Streptomyces koyangensis |
| 35 | 1130067 | 1130336 | + | NZ_CP011005.1 | Psychromicrobium lacuslunae |
| 36 | 4802930 | 4803226 | + | NZ_CP034550.1 | Saccharothrix syringae |
| 37 | 1783720 | 1784004 | - | NZ_CP016353.1 | Prauserella marina |
| 38 | 1922890 | 1923183 | + | NZ_CP051486.1 | Streptomyces pratensis |
| 39 | 2198840 | 2199115 | + | NZ_CP014989.1 | Serinicoccus hydrothermalis |
| 40 | 1236778 | 1237068 | + | NC_015312.1 | Pseudonocardia dioxanivorans CB1190 |
| 41 | 1201444 | 1201707 | - | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 42 | 3914545 | 3914868 | - | NC_009380.1 | Salinispora tropica CNB-440 |
| 43 | 1272308 | 1272604 | - | NZ_CP058277.1 | Mycobacterium marinum |
| 44 | 4440437 | 4440724 | - | NC_017093.1 | Actinoplanes missouriensis 431 |
| 45 | 417242 | 417472 | - | NZ_CP070326.1 | Streptomyces noursei |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP065425.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00903.27 | 0.91 | 41 | -3.0 | same-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
| 2 | PF18029.3 | 0.62 | 28 | -3 | same-strand | Glyoxalase-like domain |
++ More..