Result : EXP03522
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03522 |
| NCBI Accession ID | |
| Organism | Bacteroides,Prevotella |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGGTGCTGTAATAGTATCGATTTTTGTTTCGTTAATAGCAACAATTGGAGGTCTTTACTTTATGTATCAAGACAGGAAAGACCGTAAGTCCTAA |
| Sequence | MGAVIVSIFVSLIATIGGLYFMYQDRKDRKS |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 31 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 517710 | 517805 | - | NZ_CP024728.1 | Prevotella intermedia |
| 2 | 568501 | 568593 | - | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 3 | 1966530 | 1966625 | - | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014933.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01381.24 | 0.67 | 2 | 1647.5 | both-strands | Helix-turn-helix |
++ More..