Protein Information |
Information Type | Description |
---|---|
Protein name | EXP03522 |
NCBI Accession ID | |
Organism | Bacteroides,Prevotella |
Left | |
Right | |
Strand | |
Nucleotide Sequence | ATGGGTGCTGTAATAGTATCGATTTTTGTTTCGTTAATAGCAACAATTGGAGGTCTTTACTTTATGTATCAAGACAGGAAAGACCGTAAGTCCTAA |
Sequence | MGAVIVSIFVSLIATIGGLYFMYQDRKDRKS |
Source of smORF | Metagenomic Ribo-seq |
Function | |
Pubmed ID | 32601270 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 31 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 517710 | 517805 | - | NZ_CP024728.1 | Prevotella intermedia |
2 | 568501 | 568593 | - | NC_014933.1 | Bacteroides helcogenes P 36-108 |
3 | 1966530 | 1966625 | - | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01381.24 | 0.67 | 2 | 1647.5 | both-strands | Helix-turn-helix |