Result : EXP03516
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03516 |
| NCBI Accession ID | |
| Organism | Eubacterium |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGACGAAAAGTTATATAAAAAAGTAAAAGGAATAGGAGCATCAAATCTTGCATTTGGAATTATCACACTTGTGTTTGGTATTACAGCAGGAGTTATGCTTATAGTTAATGGTGCAAGACTTCTTGCACACAAATCCGACAGCCTTNTATAA |
| Sequence | MDEKLYKKVKGIGASNLAFGIITLVFGITAGVMLIVNGARLLAHKSDSLX |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 549991 | 550143 | + | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 2 | 3901856 | 3902008 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 3 | 2385106 | 2385258 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 4 | 3177608 | 3177760 | + | NZ_LR699011.1 | Roseburia hominis |
| 5 | 1059633 | 1059785 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 6 | 689330 | 689458 | + | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 7 | 1518227 | 1518355 | - | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012778.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00731.22 | 0.71 | 5 | 2923 | same-strand | AIR carboxylase |
++ More..