Result : EXP03506
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03506 |
| NCBI Accession ID | |
| Organism | |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAGAATGGACGCAAAGACCATTATCGCCATCGTGCTTGTGGCATTTATCGGCGGCGGAGCCTTGTGGCTCAACATCCGCCACAGAAAGAATAAGTAA |
| Sequence | MRMDAKTIIAIVLVAFIGGGALWLNIRHRKNK |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 32 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 444602 | 444694 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 2 | 1429530 | 1429622 | + | NZ_HF545616.1 | Ruminococcus bicirculans |
| 3 | 1147822 | 1147914 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 4 | 3172999 | 3173085 | - | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 5 | 3988046 | 3988135 | - | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 6 | 1257558 | 1257647 | - | NZ_CP029256.1 | Christensenella minuta |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR027880.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13614.8 | 0.67 | 4 | 5237.0 | same-strand | AAA domain |
| 2 | PF01656.25 | 0.67 | 4 | 5237.0 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 3 | PF10609.11 | 0.67 | 4 | 5237.0 | same-strand | NUBPL iron-transfer P-loop NTPase |
| 4 | PF02195.20 | 0.67 | 4 | 4336.0 | same-strand | ParB-like nuclease domain |
| 5 | PF17802.3 | 0.67 | 4 | 4.0 | same-strand | Prealbumin-like fold domain |
| 6 | PF08341.13 | 0.67 | 4 | 4.0 | same-strand | Thioester domain |
| 7 | PF13620.8 | 0.67 | 4 | 4.0 | same-strand | Carboxypeptidase regulatory-like domain |
++ More..