Result : C0H3Q4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YuzI |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3218215 |
| Right | 3218478 |
| Strand | - |
| Nucleotide Sequence | ATGACGATCTTTCAAAGAACGATCGTGGTTTTAATCGGTACGCAGCTGGCGGCATCCGCGGTGATTTTGTTTATTTTCGATTTGAATTCATATAATCACTTTTCCGGAAGCTTCTCCTGGCTTCATTTTCTGAAAGAACTGGCCGGCAGTTTCGCCTTTTATTTGTTTTCAGCAGGCCTGTTCTTTTTGCTGATTGGATTGTGTGCTCCAAGCCGGAAGAAAAAGCGCATTTCTGTACACGAGAAAGAAAACTCATTAAAATAA |
| Sequence | MTIFQRTIVVLIGTQLAASAVILFIFDLNSYNHFSGSFSWLHFLKELAGSFAFYLFSAGLFFLLIGLCAPSRKKKRISVHEKENSLK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H3Q4 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3218215 | 3218478 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3082417 | 3082680 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 3024197 | 3024460 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 3017039 | 3017302 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 3044253 | 3044516 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 3005136 | 3005399 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 3085335 | 3085598 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 8 | 971523 | 971786 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 3014156 | 3014419 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013984.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01894.19 | 0.89 | 8 | 3962.0 | same-strand | Uncharacterised protein family UPF0047 |
| 2 | PF00128.26 | 1.0 | 9 | 2179 | same-strand | Alpha amylase, catalytic domain |
| 3 | PF16657.7 | 1.0 | 9 | 2179 | same-strand | Maltogenic Amylase, C-terminal domain |
| 4 | PF01595.22 | 1.0 | 9 | 766 | same-strand | Cyclin M transmembrane N-terminal domain |
| 5 | PF03471.19 | 1.0 | 9 | 766 | same-strand | Transporter associated domain |
| 6 | PF00571.30 | 1.0 | 9 | 766 | same-strand | CBS domain |
| 7 | PF04298.14 | 1.0 | 9 | 45 | same-strand | Putative neutral zinc metallopeptidase |
| 8 | PF11458.10 | 1.0 | 9 | 124 | opposite-strand | Membrane-integrating protein Mistic |
| 9 | PF02254.20 | 1.0 | 9 | 377 | opposite-strand | TrkA-N domain |
| 10 | PF07885.18 | 1.0 | 9 | 377 | opposite-strand | Ion channel |
| 11 | PF08868.12 | 1.0 | 9 | 1360 | same-strand | YugN-like family |
| 12 | PF03060.17 | 0.78 | 7 | 4373 | same-strand | Nitronate monooxygenase |
++ More..