Result : EXP03496
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03496 |
| NCBI Accession ID | |
| Organism | Prevotella |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAGGTTTACAATACAGGCATTGAATGAATACGGTGAAGAAGTAGTGATAATCGGCAAAGGTGAAATGGCAAAGTGTTTCTGTCATGAATTGGAACATCTGGATGGAAAGATTTTTTTAGATAAGGCCATTGAAGAAATTGACATGTAG |
| Sequence | MRFTIQALNEYGEEVVIIGKGEMAKCFCHELEHLDGKIFLDKAIEEIDM |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1524934 | 1525110 | - | NZ_LN879430.1 | Herbinix luporum |
| 2 | 421079 | 421240 | + | NZ_CP013019.1 | Clostridium pasteurianum |
| 3 | 2129600 | 2129737 | - | NZ_CP019870.1 | Clostridioides difficile |
| 4 | 269142 | 269276 | + | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 5 | 1929349 | 1929474 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 6 | 2944579 | 2944707 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 7 | 3819301 | 3819426 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 8 | 4645236 | 4645361 | - | NZ_CP020953.1 | Clostridium drakei |
| 9 | 3676392 | 3676538 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 10 | 4146359 | 4146484 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 11 | 2521072 | 2521197 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 12 | 3173429 | 3173578 | - | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 13 | 3923184 | 3923324 | - | NZ_CP043998.1 | Clostridium diolis |
| 14 | 1838236 | 1838370 | - | NZ_CP029256.1 | Christensenella minuta |
| 15 | 4058535 | 4058678 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013019.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01381.24 | 0.6 | 9 | 311.5 | same-strand | Helix-turn-helix |
++ More..