Result : C0H3Q3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YuzH |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3213342 |
| Right | 3213596 |
| Strand | - |
| Nucleotide Sequence | ATGAACATTCTTCAATATTCTTATAAAAAAAGAGGGAAAATTGAGTTTGTATTTGAAGGCTGGCCTCACTCAAAAGTTACAATGGTTCCTATCAAAGGCTACTATTTTGTCCGCTTTATCAAATGGAGCAGCCAGGATCCAATCGTGACAAGAAATGACCTTGAAAAAATGGAGTGGGCTGCGAACCAATATTTTGGCACAGCCCCCTTCTATCGAAAACGAAAGGCATTTGAAACCCCATCGTCCGGAAAATAG |
| Sequence | MNILQYSYKKRGKIEFVFEGWPHSKVTMVPIKGYYFVRFIKWSSQDPIVTRNDLEKMEWAANQYFGTAPFYRKRKAFETPSSGK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H3Q3 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3213342 | 3213596 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3076734 | 3076988 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 3011360 | 3011614 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 3050007 | 3050261 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 2999396 | 2999650 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 3017220 | 3017474 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 7 | 3079647 | 3079901 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 8 | 3008508 | 3008759 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 977182 | 977433 | + | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 2834601 | 2834849 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 11 | 2570567 | 2570815 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 12 | 1729134 | 1729382 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 13 | 2475228 | 2475476 | + | NZ_CP043404.1 | Bacillus safensis |
| 14 | 2858590 | 2858832 | - | NZ_CP016020.1 | Bacillus weihaiensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013984.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00015.23 | 0.86 | 12 | 3528 | same-strand | Methyl-accepting chemotaxis protein (MCP) signalling domain |
| 2 | PF02743.20 | 0.86 | 12 | 5183.0 | same-strand | Cache domain |
| 3 | PF00672.27 | 0.86 | 12 | 3528 | same-strand | HAMP domain |
| 4 | PF20085.1 | 0.86 | 12 | 14.5 | opposite-strand | Protein-glutamine gamma-glutamyltransferase |
| 5 | PF01894.19 | 0.86 | 12 | 1070.0 | same-strand | Uncharacterised protein family UPF0047 |
| 6 | PF00128.26 | 0.64 | 9 | 1586 | same-strand | Alpha amylase, catalytic domain |
| 7 | PF16657.7 | 0.64 | 9 | 1586 | same-strand | Maltogenic Amylase, C-terminal domain |
| 8 | PF01595.22 | 0.79 | 11 | 3341 | same-strand | Cyclin M transmembrane N-terminal domain |
| 9 | PF03471.19 | 0.79 | 11 | 3341 | same-strand | Transporter associated domain |
| 10 | PF00571.30 | 0.79 | 11 | 3341 | same-strand | CBS domain |
| 11 | PF04298.14 | 0.79 | 11 | 4673 | same-strand | Putative neutral zinc metallopeptidase |
| 12 | PF03060.17 | 0.79 | 11 | 25 | same-strand | Nitronate monooxygenase |
++ More..